DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and ANGPT2

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001138.1 Gene:ANGPT2 / 285 HGNCID:485 Length:496 Species:Homo sapiens


Alignment Length:495 Identity:130/495 - (26%)
Similarity:201/495 - (40%) Gaps:93/495 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 NNFR----SIATPPIAPR---CDYKELMTNLHD-------RVGILVTLD-----EDQRHRLEVID 98
            ||||    ||.......:   |.|..|:..:.:       .|...|..|     :|...||:|::
Human    20 NNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLE 84

  Fly    99 K----------KLDQLVESSSARMESMKAQQLDFLHRLDSFEHI-QRLSRNTLDELKGETD---Q 149
            .          ||:..:: .:.:.|.::.||....::......| ..|...|.::.:..||   |
Human    85 NIMENNTQWLMKLENYIQ-DNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQ 148

  Fly   150 VFGPRNVRE---LKHKLRNRKKMKDISRTVRDVSQEQYPSSGIGTFNESNLNLSSRLDALATLLA 211
            |.......|   |:|.|...|..|.|.....::::.|          :.|..|..::.|:..   
Human   149 VLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQ----------DKNSFLEKKVLAMED--- 200

  Fly   212 STALSVRSVQVEVANLSRAIRRQSRLI-------------------QGKGLRSTPGQQPIFYGPS 257
            ...:.::|::.|...|...:.:|:.:|                   |...|..|..........|
Human   201 KHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTS 265

  Fly   258 -GLNGPTATRQLPSS---CSYSFLSNH---GILKVQLTPESESFYVSCDED-----WTVILSRTS 310
             ....||..::...|   |:..|.|.|   ||..:.....:|.....||.:     ||:|..|..
Human   266 NSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRRED 330

  Fly   311 DDVNFERGWLDYRDGFGNLAGDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLFAIGSE 375
            ..|:|:|.|.:|:.||||.:|::::|...:..||:...:.|:|.::|:.||.||:.|..|.:.||
Human   331 GSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSE 395

  Fly   376 KELYPLVLLGKFQDNLTPSAG--DSLSYHAGAKFSTVDQDNDNCLECNCALRHKGAGWFNNCAKS 438
            :..|.:.|.|     ||.:||  .|:| ..|..|||.|.|||.|: |.|:....|..||:.|..|
Human   396 ELNYRIHLKG-----LTGTAGKISSIS-QPGNDFSTKDGDNDKCI-CKCSQMLTGGWWFDACGPS 453

  Fly   439 NLFGEYTTQNQPGE--TGIWWDTFSGQN-SLKRVRWMIRP 475
            ||.|.|..|.|...  .||.|..:.|.. |||....||||
Human   454 NLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 80/225 (36%)
ANGPT2NP_001138.1 SMC_N <78..>295 CDD:330553 42/230 (18%)
FBG 280..494 CDD:214548 80/221 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.