DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and ANGPTL2

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_036230.1 Gene:ANGPTL2 / 23452 HGNCID:490 Length:493 Species:Homo sapiens


Alignment Length:435 Identity:118/435 - (27%)
Similarity:187/435 - (42%) Gaps:95/435 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 QRHRLEVIDKKLD---------QLVESSSARMESMKAQ-QLDFLHRL----DSFEHIQRLSRNTL 140
            |:.::|.:.:.::         :|:...|..|.|...| .:..||.:    |:...:.:|....|
Human    99 QKRQIETLQQLVEVDGGIVSEVKLLRKESRNMNSRVTQLYMQLLHEIIRKRDNALELSQLENRIL 163

  Fly   141 DELKGETDQVFGPRNVRELKHKLRNRKKMKDISRTVRDVSQEQYPSSGIGTFNESNLNLSSRLDA 205
            ::   ..|.:......::|:||.::                       :.|...:...:.::|:.
Human   164 NQ---TADMLQLASKYKDLEHKYQH-----------------------LATLAHNQSEIIAQLEE 202

  Fly   206 LATLLAST--------ALSVRSVQVEVANLSRAIRRQS--RLIQGKGLRSTPGQQPIFYGPSGLN 260
            ....:.|.        |...|..|....|  |.|.:.|  .:...:.|:..|...|..       
Human   203 HCQRVPSARPVPQPPPAAPPRVYQPPTYN--RIINQISTNEIQSDQNLKVLPPPLPTM------- 258

  Fly   261 GPTATRQLPSS----------CSYSFLSNHGILKVQLT-PESES--FYVSCDE-----DWTVILS 307
             ||.| .||||          |..:....|....:.|. ||:.:  ..|.||:     .||||..
Human   259 -PTLT-SLPSSTDKPSGPWRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHDPGGWTVIQR 321

  Fly   308 RTSDDVNFERGWLDYRDGFGNLAGDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLFAI 372
            |....|||.|.|..|:.||||:.|::::||..::.||:...::|.:.|||:||...:|.|:.|.:
Human   322 RLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRL 386

  Fly   373 GSEKELYPLVLLGKFQDNLTPSAGDSLSYHAGAKFSTVDQDNDNCLECNCALRHKGAGWFNNCAK 437
            ..|.|.|.| .||::..|    ||||.::|.|.:|:|:|:|:| ....|||...||..|:|.||.
Human   387 EPESEYYKL-RLGRYHGN----AGDSFTWHNGKQFTTLDRDHD-VYTGNCAHYQKGGWWYNACAH 445

  Fly   438 SNL------FGEYTTQNQPGETGIWWDTF-SGQNSLKRVRWMIRP 475
            |||      .|.|.::.|   .|::|..| .|..|||:|..||||
Human   446 SNLNGVWYRGGHYRSRYQ---DGVYWAEFRGGSYSLKKVVMMIRP 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 86/234 (37%)
ANGPTL2NP_036230.1 FReD 273..487 CDD:238040 80/222 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.