DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and FGL1

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_004458.3 Gene:FGL1 / 2267 HGNCID:3695 Length:312 Species:Homo sapiens


Alignment Length:303 Identity:99/303 - (32%)
Similarity:140/303 - (46%) Gaps:42/303 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 LLASTALSV-RSVQV--EVANLSRAIRRQSRLIQG---------KGLRSTPGQQPIFYGPSGLNG 261
            :|.:|||:: |.:..  :.|.....:|.|.||::.         |.|......|.:..|......
Human     8 ILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVI 72

  Fly   262 PTATRQLPSSCSYSFLSNH---GILKVQLTPESESFYVSCDED----WTVILSRTSDDVNFERGW 319
            ...:::..:.||..|...:   |..|::.......|.|.||..    ||||..|:....||.|||
Human    73 DLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGW 137

  Fly   320 LDYRDGFGNLA---GDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLFAIGSEKELYPL 381
            .||.:||||..   |::::|...||.||:...:.|:|.:.||..|..||.|..|.:|.||..|.|
Human   138 KDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYEL 202

  Fly   382 VLLGKFQDNLTPSAGDSL-----------SYHAGAKFSTVDQDNDNCLECNCALRHKGAGWFNNC 435
             .:|::    :.:|||||           :.|...||||.|:|:|| .|.|||...:...|||.|
Human   203 -NIGEY----SGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDN-YEGNCAEEDQSGWWFNRC 261

  Fly   436 AKSNLFGEYTTQNQPGET--GIWWDTFSG-QNSLKRVRWMIRP 475
            ..:||.|.|.:.....:|  ||.|.|:.| ..|||.|...|||
Human   262 HSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 85/233 (36%)
FGL1NP_004458.3 FReD 78..304 CDD:238040 83/231 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.