DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and FGG

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_068656.2 Gene:FGG / 2266 HGNCID:3694 Length:453 Species:Homo sapiens


Alignment Length:438 Identity:102/438 - (23%)
Similarity:174/438 - (39%) Gaps:104/438 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 VIDKKLDQLVESSSARMESMKAQQLDFLHRLDSFEHIQRLSRNTLDELKG---------ETDQVF 151
            ::|::......::....:.:...|......|.|.|.|.....|...|:|.         ..|:..
Human    36 ILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESS 100

  Fly   152 GPRNVRELKHKLRNRKKMKDI-----SRTVRDVS----QEQYPSSGIGTFNESNLNLSSRLDALA 207
            .|..:...  .|::||.:::|     |....|.|    ||.|.|:     |:..:||..:   :|
Human   101 KPNMIDAA--TLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSN-----NQKIVNLKEK---VA 155

  Fly   208 TLLASTALSVRSVQVEVANLSRAIRRQSRLIQGKGLRSTPGQQPIFYGPSGLNGPTATRQLPSSC 272
            .|.|......:.. |::.:::   .:..:.|..||.:.:                          
Human   156 QLEAQCQEPCKDT-VQIHDIT---GKDCQDIANKGAKQS-------------------------- 190

  Fly   273 SYSFLSNHGILKVQLTPESESFYVSCDED-----WTVILSRTSDDVNFERGWLDYRDGFGNLA-- 330
                    |:..::....::.|.|.|:.|     |||...|....|:|::.|:.|::|||:|:  
Human   191 --------GLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPT 247

  Fly   331 --GDFFIGLNKLHAL-TSSAL-HELRIVMEDFSGNVAYAGYSLFAIGSEKELYPLVLLGKFQDNL 391
              .:|::|..|:|.: |.||: :.||:.:||::|..:.|.|::|.:|.|.:.|.|. ...|....
Human   248 GTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLT-YAYFAGGD 311

  Fly   392 TPSAGDSLSY-----------HAGAKFSTVDQDNDNCLECNCALRHKGAGWFNNCAKSNL----- 440
            ...|.|...:           |.|.:|||.|.|||. .|.|||.:.....|.|.|...:|     
Human   312 AGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDK-FEGNCAEQDGSGWWMNKCHAGHLNGVYY 375

  Fly   441 -FGEYTTQNQPG--ETGIWWDTFSGQ-NSLKRVRWMIRP-----ISEG 479
             .|.|:..:.|.  :.||.|.|:..: .|:|:....|.|     |.||
Human   376 QGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGEG 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 67/244 (27%)
FGGNP_068656.2 Fib_alpha 31..172 CDD:285864 29/146 (20%)
FReD 175..414 CDD:294064 69/277 (25%)
Gamma-chain polymerization, binding amino end of another fibrin alpha chain 400..422 5/21 (24%)
Platelet aggregation and Staphylococcus clumping 423..437 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 424..453 102/438 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.