DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and FGB

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_005132.2 Gene:FGB / 2244 HGNCID:3662 Length:491 Species:Homo sapiens


Alignment Length:510 Identity:115/510 - (22%)
Similarity:190/510 - (37%) Gaps:139/510 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EVPGVTQAPPLPPRNLRNNQTRSRIPNNFRSIATPPIAPRCDYKELMTNLHDRVGILVTLDEDQR 91
            |.|.:..|||    .:.....|:|           |.......|::.....|..|.|        
Human    55 EAPSLRPAPP----PISGGGYRAR-----------PAKAAATQKKVERKAPDAGGCL-------- 96

  Fly    92 HRLEVIDKKLDQLVESSSARMESMKAQQLDFLHRLDSFEHIQRLSRNTLDELKGETDQVFGPRN- 155
            |    .|..|..|..:.....|::..|              :|..||::|||....:.|....: 
Human    97 H----ADPDLGVLCPTGCQLQEALLQQ--------------ERPIRNSVDELNNNVEAVSQTSSS 143

  Fly   156 -------VRELKHKLRNRKKMKDISRTVRDVSQE-----QYPSSGIGTFNESNLNLSSRLDALAT 208
                   :::|..|  .:|::||....|.:.|.|     .|....:      |.|:.:.|..|.:
Human   144 SFQYMYLLKDLWQK--RQKQVKDNENVVNEYSSELEKHQLYIDETV------NSNIPTNLRVLRS 200

  Fly   209 LLASTALSVR------SVQVEVANLSRAIRRQSRLIQGKGLRSTPGQQPIFYGPSGLNGPTATRQ 267
            :|.:....::      |.|:|.......:.....::.||..     ::.|..|     |.|:...
Human   201 ILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKEC-----EEIIRKG-----GETSEMY 255

  Fly   268 LPSSCSYSFLSNHGILKVQLTPES--ESFYVSCDED-----WTVILSRTSDDVNFERGWLDYRDG 325
            |                  :.|:|  :.:.|.||.:     ||||.:|....|:|.|.|..|:.|
Human   256 L------------------IQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQG 302

  Fly   326 FGNLA------------GDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLFAIGSEKEL 378
            |||:|            |::::|.:|:..||.....||.|.|||:.|:...|.|..|.:.:|...
Human   303 FGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANK 367

  Fly   379 YPLVLLGKFQ--------DNLTPSAGD--SLSYHAGAKFSTVDQDNDNCLECN----CALRHKGA 429
            |. :.:.|::        |..:...|:  :::.|.|..|||.|:|||..|..:    |:....|.
Human   368 YQ-ISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGG 431

  Fly   430 GWFNNCAKSNLFGEYTTQNQ--------PGETGIWWDTFSGQ-NSLKRVRWMIRP 475
            .|:|.|..:|..|.|....|        ..:.|:.|..:.|. .|::::...|||
Human   432 WWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRP 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 67/251 (27%)
FGBNP_005132.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..75 7/34 (21%)
Beta-chain polymerization, binding distal domain of another fibrin 45..47
Fib_alpha 92..234 CDD:312286 32/175 (18%)
FReD 237..486 CDD:294064 71/277 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.