powered by:
Protein Alignment CG10359 and B0393.7
DIOPT Version :9
Sequence 1: | NP_001137882.1 |
Gene: | CG10359 / 38434 |
FlyBaseID: | FBgn0035452 |
Length: | 485 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_497983.4 |
Gene: | B0393.7 / 181958 |
WormBaseID: | WBGene00007172 |
Length: | 267 |
Species: | Caenorhabditis elegans |
Alignment Length: | 57 |
Identity: | 14/57 - (24%) |
Similarity: | 22/57 - (38%) |
Gaps: | 4/57 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 CGFGTGSVLEVPGV---TQAPPLPPRNLRNNQTRSRIPNNFRSIATPPIAPRCDYKE 71
||.|:...:...|: |...|.|...| :..|.:..|...:......::.|||..|
Worm 135 CGDGSDEDVCAHGMVSCTSNEPTPTPIL-DAITSTEKPKEPKKKTALQVSKRCDLGE 190
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG10359 | NP_001137882.1 |
FReD |
267..476 |
CDD:238040 |
|
B0393.7 | NP_497983.4 |
LDLa |
111..144 |
CDD:238060 |
3/8 (38%) |
LDLa |
186..220 |
CDD:238060 |
3/5 (60%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2579 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.