DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and B0393.7

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_497983.4 Gene:B0393.7 / 181958 WormBaseID:WBGene00007172 Length:267 Species:Caenorhabditis elegans


Alignment Length:57 Identity:14/57 - (24%)
Similarity:22/57 - (38%) Gaps:4/57 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CGFGTGSVLEVPGV---TQAPPLPPRNLRNNQTRSRIPNNFRSIATPPIAPRCDYKE 71
            ||.|:...:...|:   |...|.|...| :..|.:..|...:......::.|||..|
 Worm   135 CGDGSDEDVCAHGMVSCTSNEPTPTPIL-DAITSTEKPKEPKKKTALQVSKRCDLGE 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040
B0393.7NP_497983.4 LDLa 111..144 CDD:238060 3/8 (38%)
LDLa 186..220 CDD:238060 3/5 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.