DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and Y43C5A.2

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_501883.1 Gene:Y43C5A.2 / 177911 WormBaseID:WBGene00012782 Length:452 Species:Caenorhabditis elegans


Alignment Length:258 Identity:74/258 - (28%)
Similarity:106/258 - (41%) Gaps:62/258 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 PTATRQLPSSCS-YSFLSNHGILKVQLTPESESFYVSCDE----DWTVILSR--TSDDVNFERGW 319
            ||.|.:.|..|| .|.|::.|:..:.  |......|.||.    .:|||.||  |.::|||...:
 Worm   188 PTTTPKPPMDCSEISNLTSSGVQTIY--PNGSPVQVYCDTTSYGTYTVIQSRGATGENVNFNITY 250

  Fly   320 LDYRDGFGNLAGD--FFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLFAIGSEKELYPLV 382
            ..|.|..|....:  |:.||:.::.|:.:..:.|:|.:...:..||...|..|.:|:.:..|   
 Worm   251 DKYTDIIGTPGKETNFWFGLDNMNHLSGAKPYRLQIDLCCGTLLVAKQIYHSFKVGTAEYGY--- 312

  Fly   383 LLGKFQDNLTPSA---GDSLSYHA-----GAKFSTVDQ-----DNDNCLE------CNCALRHKG 428
                   |||.:|   |..|:|.:     ||||||.|.     ..|:|.|      .....:..|
 Worm   313 -------NLTATADISGIGLAYSSTYTDLGAKFSTFDNFTGPLGKDDCDEFQYFDDSGVQSQPYG 370

  Fly   429 AGWFNNCAKSNLFG-EYTTQN----QPGET-------GIWWDTFSGQN---------SLKRVR 470
            ..|:.:|. :||.| .|..:|    .|.|.       ||...|.|||.         |..|||
 Worm   371 GWWYGSCG-NNLNGFWYPKRNGNCTVPDEVFKNTTMLGINMRTTSGQGYGGYNVDMVSYDRVR 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 71/253 (28%)
Y43C5A.2NP_501883.1 FReD 196..438 CDD:238040 70/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.