DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and Fcnb

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_446086.1 Gene:Fcnb / 114091 RGDID:621222 Length:319 Species:Rattus norvegicus


Alignment Length:240 Identity:91/240 - (37%)
Similarity:124/240 - (51%) Gaps:22/240 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 KGLRSTPGQQPIFYGPSG--LNGPTATRQLPSSCSYSFLSNHGILKVQLTPESESFYVSCDED-- 301
            ||:|...|..    |||.  ..||...::|.:. .| ||:  |...:.| |:.....|.||.|  
  Rat    89 KGVRGEKGDT----GPSQSCATGPRTCKELLTR-GY-FLT--GWYTIYL-PDCRPLTVLCDMDTD 144

  Fly   302 ---WTVILSRTSDDVNFERGWLDYRDGFGNLAGDFFIGLNKLHALTSSALHELRIVMEDFSGNVA 363
               |||...|....|:|.|.|..|:.|||:..|:|::|.:.:||||:...:|||:.:.||.||..
  Rat   145 GGGWTVFQRRIDGTVDFFRDWTSYKQGFGSQLGEFWLGNDNIHALTTQGTNELRVDLADFDGNHD 209

  Fly   364 YAGYSLFAIGSEKELYPLVLLGKFQDNLTPSAGDSLSYHAGAKFSTVDQDNDNCLECNCALRHKG 428
            :|.||.|.|..|.|.|.|: ||.|   |...|||||:......|||.|||||.. ..|||:|:.|
  Rat   210 FAKYSSFQIQGEAEKYKLI-LGNF---LGGGAGDSLTSQNNMLFSTKDQDNDQG-SSNCAVRYHG 269

  Fly   429 AGWFNNCAKSNLFGEYTT-QNQPGETGIWWDTFSGQNSLKRVRWM 472
            |.|:::|..|||.|.|.. .::....|:.|.::.|.|...:|..|
  Rat   270 AWWYSDCHTSNLNGLYLRGLHKSYANGVNWKSWKGYNYSYKVSEM 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 82/212 (39%)
FcnbNP_446086.1 Collagen 45..100 CDD:189968 4/14 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..106 7/20 (35%)
FReD 108..317 CDD:238040 83/217 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.