DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and LOC108179162

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_017211437.2 Gene:LOC108179162 / 108179162 -ID:- Length:243 Species:Danio rerio


Alignment Length:224 Identity:78/224 - (34%)
Similarity:108/224 - (48%) Gaps:25/224 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 PSSCSYSFLSNHGILKV-QLTPESE-SFYVSC-------DED---WTVILSRTSDDVNFERGWLD 321
            |..||..:.|...:..: .:.|..: ..:|.|       ||:   |||...|....:||.:.|.:
Zfish    24 PFDCSEIYRSGQTVSGIYSIYPAGDIPVWVYCQMISDGKDEENGGWTVFQRRMDGRINFYQPWEE 88

  Fly   322 YRDGFGNLAGDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLFAIGSEKELYPLVLLGK 386
            |:.|||...|::::||..|:.||......||:.:|||.|...:|.||.|::|||.|.|.|.:.| 
Zfish    89 YKRGFGTTEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRRGFAQYSSFSVGSEAEGYRLQVSG- 152

  Fly   387 FQDNLTPSAGDSLSYHAGAKFSTVDQDNDNCLECNCALRHKGAGWFNNCAKSNLFGEYTTQNQPG 451
            |.|.   .|||||:.|...||||.|:|.| ....|||....||.||..|..:|..|.|.......
Zfish   153 FTDG---GAGDSLTDHNDQKFSTFDKDQD-AYGDNCAQEFLGAFWFKYCHNTNPNGVYLWGEDDT 213

  Fly   452 ETGI------WWDTFSGQNSLKRVRWMIR 474
            ..||      |.|:|:  .|:|.:..||:
Zfish   214 HFGIGVVWSTWKDSFT--VSMKSLSLMIK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 78/224 (35%)
LOC108179162XP_017211437.2 FReD 24..242 CDD:238040 78/224 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.