DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and ANGPTL7

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_066969.1 Gene:ANGPTL7 / 10218 HGNCID:24078 Length:346 Species:Homo sapiens


Alignment Length:372 Identity:116/372 - (31%)
Similarity:165/372 - (44%) Gaps:84/372 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 IQRLSR------------NTLDELKGETDQVFGPRNVRELKHKLRNRKKMKDISRTVRDVSQEQY 184
            :|:||:            |..:|:|....||   .|:..|..:| |:|:.:|....|..|.:   
Human    26 LQKLSKHKTPAQPQLKAANCCEEVKELKAQV---ANLSSLLSEL-NKKQERDWVSVVMQVME--- 83

  Fly   185 PSSGIGTFNESNLNLSSRLDALATLLASTALSVRSVQVEVANLSRAIRRQSRLIQGKGLRSTPGQ 249
                    .|||   |.|:::..| .|.:..|..:.|:::..|..|                   
Human    84 --------LESN---SKRMESRLT-DAESKYSEMNNQIDIMQLQAA------------------- 117

  Fly   250 QPIFYGPSGLNGPTATRQLPSS---CSYSFLSNHGILKV-QLTPE----SESFYVSCDED----- 301
                        .|.|:....:   ||..:..|:.|..| :|.|:    |....|.||.:     
Human   118 ------------QTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGG 170

  Fly   302 WTVILSRTSDDVNFERGWLDYRDGFGNLAGDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAG 366
            ||:|..|.|..|:|.|.|..|:.|||::.|||::|...:|.|:.... .||:.|||:.||:.||.
Human   171 WTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPT-RLRVEMEDWEGNLRYAE 234

  Fly   367 YSLFAIGSEKELYPLVLLGKFQDNLTPSAGDSLSYHAGAKFSTVDQDNDNCLECNCALRHKGAGW 431
            ||.|.:|:|...|.| .||.:..|:   ..|:|.||....|||.|:||||||: .||...||..|
Human   235 YSHFVLGNELNSYRL-FLGNYTGNV---GNDALQYHNNTAFSTKDKDNDNCLD-KCAQLRKGGYW 294

  Fly   432 FNNCAKSNLFGEYTTQNQPGE--TGIWWDTFSGQN-SLKRVRWMIRP 475
            :|.|..|||.|.|....:..:  .||.|..:.|.. |||||...|||
Human   295 YNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRP 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 87/225 (39%)
ANGPTL7NP_066969.1 SMC_N <37..>109 CDD:330553 21/90 (23%)
FReD 129..341 CDD:238040 85/217 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.