DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and mfap4.8

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_003197840.1 Gene:mfap4.8 / 100538028 ZFINID:ZDB-GENE-121214-168 Length:243 Species:Danio rerio


Alignment Length:225 Identity:81/225 - (36%)
Similarity:112/225 - (49%) Gaps:21/225 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 PSSCSYSFLSNHGILKV-QLTPESES-FYVSC----------DEDWTVILSRTSDDVNFERGWLD 321
            |..||..:.|...:..: .:.|..:: .:|.|          :|.|||...|....::|.:.|..
Zfish    24 PFDCSEIYKSGQTVSGIYSIYPAGDTPVWVYCQMVSDGKVEENEGWTVFQRRMDGSIHFFQLWEK 88

  Fly   322 YRDGFGNLAGDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLFAIGSEKELYPLVLLGK 386
            ||.|||...|::::||..|:.||......||:.:|||:|...:|.||.|::|||.|.|.|.|.| 
Zfish    89 YRIGFGTTEGEYWLGLENLYQLTRHKKFMLRVDLEDFTGRRGFAQYSSFSVGSEVEGYKLELSG- 152

  Fly   387 FQDNLTPSAGDSLSYHAGAKFSTVDQDNDNCLECNCALRHKGAGWFNNCAKSNLFGEYTTQNQPG 451
            |.|.   .||||||||.|.||||.|:|.|. .|.|||....||.|:..|..:|..|.|.......
Zfish   153 FTDG---GAGDSLSYHNGMKFSTYDRDQDT-NEDNCARMRLGAFWYKGCNYANPNGVYLWGEDKS 213

  Fly   452 ETGIW--WDTFSGQNS--LKRVRWMIRPIS 477
            :.||.  |.|:...|.  :|.:...|:|:|
Zfish   214 KNGIAINWYTWKNDNETPMKFITMKIKPVS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 79/222 (36%)
mfap4.8XP_003197840.1 FReD 24..242 CDD:238040 79/222 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.