DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and mfap4.10

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001314993.1 Gene:mfap4.10 / 100537823 ZFINID:ZDB-GENE-121214-100 Length:245 Species:Danio rerio


Alignment Length:231 Identity:77/231 - (33%)
Similarity:117/231 - (50%) Gaps:33/231 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 PSSCSYSFLSNH---GILKV------------QLTPESESFYVSCDEDWTVILSRTSDDVNFERG 318
            |..||..:.|..   ||..:            |:..|.:   |..:..|||...|....:||.:.
Zfish    26 PFDCSEIYKSGQTGSGIYSIYPAGNTPVWVYCQMISEGK---VQDNGGWTVFQRRLDGRINFYQP 87

  Fly   319 WLDYRDGFGNLAGDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLFAIGSEKELYPLVL 383
            |.:|:.|||...|::::||..|:.||....:.||:.:|||:|...:|.||.|::|||.|.|.|.:
Zfish    88 WEEYKRGFGTTEGEYWLGLENLYQLTRHKNYMLRVDLEDFTGRRGFAQYSSFSVGSEAEGYKLQI 152

  Fly   384 LGKFQDNLTPSAGDSLSYHAGAKFSTVDQDNDNCLEC-NCALRHKGAGWFNNCAKSN-----LFG 442
            .| |.|.   .||||:::|.|.||||.|:|.|  ::. |||....||.|:.||..:|     :.|
Zfish   153 SG-FTDG---GAGDSMTHHNGMKFSTYDKDQD--IDSRNCARLRLGAFWYRNCYYANPNGVYIGG 211

  Fly   443 EYTTQNQPGETGIWWDTFSGQN-SLKRVRWMIRPIS 477
            |.:|....|:  :|:...:..| .:|.:...|:|:|
Zfish   212 EDSTIYAIGD--VWYSWKNNANFGMKLITMKIKPVS 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 75/228 (33%)
mfap4.10NP_001314993.1 FReD 26..244 CDD:238040 75/228 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.