DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and LOC100496379

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_031746585.1 Gene:LOC100496379 / 100496379 -ID:- Length:490 Species:Xenopus tropicalis


Alignment Length:247 Identity:90/247 - (36%)
Similarity:118/247 - (47%) Gaps:32/247 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 GPSGLNGPT--ATRQ---------LPSSCSYSFLSNHGIL---KVQLTPE-SESFYVSCD----- 299
            ||.||.|.|  |..|         .|:..:...|..:|:|   ...:.|: ::...|.||     
 Frog   251 GPPGLKGDTGPAGHQGEKGESRVWYPAVKNCMELRTYGVLFSGWYTIYPDGNKPLNVLCDMHTDG 315

  Fly   300 EDWTVILSRTSDDVNFERGWLDYRDGFGNLAGDFFIGLNKLHALTSSALHELRIVMEDFSGNVAY 364
            ..|.|...|....|:|.|.|..||.|||:...:|::|...:|.||||...:|||.:|||..|..|
 Frog   316 GGWIVFQKRMDGSVDFYRDWGSYRQGFGSQLSEFWLGNENIHRLTSSGNIQLRIDLEDFDNNRTY 380

  Fly   365 AGYSLFAIGSEKELYPLVLLGKFQDNLTPSAGDSLSYHAGAKFSTVDQDNDNCLECNCALRHKGA 429
            |.||.|.:..|.:.|.| .||.|...   :||||||.|....|::.|.|.|..:..|||.::|||
 Frog   381 ATYSQFRLEPESQKYTL-RLGAFTGG---TAGDSLSSHNNKAFASKDADYDESVNSNCAEKYKGA 441

  Fly   430 GWFNNCAKSNLFGEYTT----QNQPGETGIWWDTFSGQN-SLKRVRWMIRPI 476
            .|:..|..:.|.|||..    ||.   .||.|.||.|.| |||:.....||:
 Frog   442 WWYVKCYDACLNGEYLRGPLGQNY---GGIAWKTFRGYNYSLKKSEMKFRPL 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 82/231 (35%)
LOC100496379XP_031746585.1 Collagen 91..144 CDD:396114
Collagen <213..270 CDD:396114 8/18 (44%)
FReD 276..490 CDD:238040 81/220 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.