DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and fgl2

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_002933134.2 Gene:fgl2 / 100494596 XenbaseID:XB-GENE-482375 Length:429 Species:Xenopus tropicalis


Alignment Length:394 Identity:104/394 - (26%)
Similarity:168/394 - (42%) Gaps:100/394 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 PRNVRELKHKLRNRKKMKDISRTVRDVSQ---------------EQYPSSGIGTFNESNLNLSSR 202
            |:..:.|:..::..:.:|:|...::...|               :|.|.|..|..:.:...|.|:
 Frog    64 PKQFQLLEKTIKEVQSLKEIVNALKKSCQDCKLQADDTPEKDNGQQNPESTNGDQDNNIHELQSK 128

  Fly   203 LDALATLLASTALSVRSVQVEVANLSRAIRRQSRLIQGKGLRSTPGQQPI-------FYGPSGLN 260
            :..::..|.:....:.|:|.::..:|                      ||       :.....:|
 Frog   129 VKKMSISLKNARNQINSLQEQLGKMS----------------------PINMNTIEQYVDTKMIN 171

  Fly   261 GPTATRQLPSSCSYSFLSNHGILK----VQL---------------------TPE--SESFYVSC 298
            ...|...|.:.||    ||..:|:    :||                     ||:  :::|.|.|
 Frog   172 LSFALNNLDNKCS----SNCPVLEANPSIQLLYKDCSDYYKIGKKVDGRYRVTPDEKNKTFEVYC 232

  Fly   299 DED-----WTVILSRTSDDVNFERGWLDYRDGFGNLAGDFFIGLNKLHALTSSALHELRIVMEDF 358
            |.:     |||:..|.....:|.|.|.:|::|||||.|:|::|.:|||.||.|....|||.:|||
 Frog   233 DMESMGGGWTVVQIRKDGSTSFNRTWNEYKNGFGNLTGEFWLGNDKLHLLTKSTDMILRIELEDF 297

  Fly   359 SGNVAYAGYSLFAIGSEKELYPLVLLGKFQDNLTPSAGDSLSY-----HAGAKFSTVDQDNDNCL 418
            .||..||.|..|.:.:|...|.|.:.|     .:.:|||:|.:     |....|:|.|:|||...
 Frog   298 KGNREYAKYDQFYVANEYLKYRLTIGG-----YSGTAGDALHFSKQYNHDQKFFTTPDKDNDRYP 357

  Fly   419 ECNCALRHKGAGWFNNCAKSNLFGEYTTQNQPG-ETGIWWDTFSG---------QNSLKRVRWMI 473
            ..||...:....||:.|..:||.|:|...:..| ..||:|.|::|         :.:.|.|:.||
 Frog   358 SGNCGSYYSSGWWFDACMSANLNGKYYKNDYKGVRNGIFWGTWTGVSDEHLNSYRQTFKFVKMMI 422

  Fly   474 RPIS 477
            ||.|
 Frog   423 RPKS 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 83/255 (33%)
fgl2XP_002933134.2 Smc <53..164 CDD:224117 17/121 (14%)
FReD 199..425 CDD:238040 75/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.