DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and LOC100493748

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_002945140.2 Gene:LOC100493748 / 100493748 -ID:- Length:227 Species:Xenopus tropicalis


Alignment Length:231 Identity:73/231 - (31%)
Similarity:107/231 - (46%) Gaps:20/231 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 GPSGLNGPTATRQLPSSCSYSFLSNHGILK---VQLTPESES-FYVSCDED-----WTVILSRTS 310
            |..|:||....|    :|..  |.:.|::.   ..:.|:..: ..|.||.|     |.|...|..
 Frog     8 GEKGVNGTNGAR----NCKE--LLHQGVVMSGWYTIYPDGMAPLQVLCDMDTDGGGWIVFQRRYD 66

  Fly   311 DDVNFERGWLDYRDGFGNLAGDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLFAIGSE 375
            ..|:|..||..|:.|||:...:|::|.:.|...|||...|:|:.:.||.....||.||.|.:..|
 Frog    67 GSVDFYLGWDSYKRGFGSRLTEFWLGNDNLSNFTSSGTWEMRVDLRDFDNIQHYAKYSSFRVLPE 131

  Fly   376 KELYPLVLLGKFQDNLTPSAGDSLSYHAGAKFSTVDQDNDNCLECNCALRHKGAGWFNNCAKSNL 440
            .:.|.|: :|.:   :...||||:||...:||:|.|:||| ..|..||...:||.|:..|..:||
 Frog   132 SDSYTLI-IGPY---VAGDAGDSMSYSNYSKFTTKDRDND-MYEGKCADIDRGAWWYKICYNANL 191

  Fly   441 FGEYTTQNQPGETGIWWDTFSGQNSLKRVRWMIRPI 476
            .|.|..........|.|.:.....|.|.....:||:
 Frog   192 NGFYHLAQNYNIDSICWLSLGSYYSFKFTEMKMRPV 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 67/217 (31%)
LOC100493748XP_002945140.2 FReD 19..227 CDD:238040 68/218 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.