DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and mfap4.1

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_012826910.1 Gene:mfap4.1 / 100488644 XenbaseID:XB-GENE-997605 Length:256 Species:Xenopus tropicalis


Alignment Length:227 Identity:79/227 - (34%)
Similarity:110/227 - (48%) Gaps:20/227 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 TRQLPSSCSYSFLSN---HGILKVQLTPESESFYVSCD-----EDWTVILSRTSDDVNFERGWLD 321
            |.|.|:.|.....:.   .|:..:.....|.:..|.||     ..||||..|.:..::|.|||.|
 Frog    35 TEQFPADCEEVHAAGAEADGVYVIYPAGSSSAVPVYCDMTTDGGKWTVIQKRFNGTLSFFRGWTD 99

  Fly   322 YRDGFGNLAGDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLF-----AIGSEKELYPL 381
            |:.|||....::::||:.::.||....:||||.:.||..|..:|.|..|     ||..|.:.|.|
 Frog   100 YKLGFGRADEEYWLGLHNIYQLTLRRKYELRIDLGDFENNTVHAKYGDFSLSPKAINPEDDGYTL 164

  Fly   382 VLLGKFQDNLTPSAGDSLSYHAGAKFSTVDQDNDNCLECNCALRHKGAGWFNNCAKSNLFGEYTT 446
             .:.:|.|.   .|||||:||:|.||||.|:|.|. .:.|||....|..||..|..:||.|.|..
 Frog   165 -YVEEFTDG---GAGDSLTYHSGMKFSTYDRDRDT-YQQNCASLSAGGFWFRACHLANLNGPYLR 224

  Fly   447 -QNQPGETGIWWDTFSG-QNSLKRVRWMIRPI 476
             .:....:||.|..:.| ..|||.....||.:
 Frog   225 GAHLSYGSGIIWSGWKGLYYSLKSTEMKIRRV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 78/223 (35%)
mfap4.1XP_012826910.1 FReD 37..256 CDD:238040 78/223 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.