DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and XB5913531

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_012826224.3 Gene:XB5913531 / 100488177 XenbaseID:XB-GENE-5913532 Length:255 Species:Xenopus tropicalis


Alignment Length:246 Identity:78/246 - (31%)
Similarity:113/246 - (45%) Gaps:48/246 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 KGLRSTPGQQPIFYGPSGLNGPTATRQLPSSCSYSFLSNHGILKVQLTPESESFYVSCDEDWTVI 305
            ||.|| .|:..|:  |.|...|     ||..|.   ::.:|:                  .|||.
 Frog    44 KGFRS-DGEYLIY--PQGPQHP-----LPVYCD---MTTNGM------------------PWTVF 79

  Fly   306 LSRTSDDVNFERGWLDYRDGFGNLAGDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLF 370
            ..|.....:|.:.|.||..||||...::::||..:..||.:..:|||:.:|:|:|...||.||.|
 Frog    80 QKRFDGSTDFNQNWQDYVMGFGNADYEYWLGLQNIQRLTMTGRYELRVELENFNGQKVYAFYSNF 144

  Fly   371 -----AIGSEKELYPLVLLGKFQDNLTPSAGDSLSYHAGAKFSTVDQDNDNCLECNCALRHKGAG 430
                 |:.:|.:.|.|.:.| |.|.   .||||||.|.|.:|||.|.|..|.:: |||....|..
 Frog   145 SLSPQALNAEHDGYKLYVDG-FTDG---GAGDSLSVHVGQRFSTYDNDQINDIQ-NCAEYWGGGF 204

  Fly   431 WF--NNCAKSNLFGEYTTQN-----QPGETGIWWDTFSGQNSLKRVRWMIR 474
            |:  |.||.:.|...|...|     |.|.:.:.|..:  ..:|:..:.|:|
 Frog   205 WYYSNGCADAGLNARYINPNTLKSPQHGFSWVTWVEY--PETLRASQMMMR 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 69/220 (31%)
XB5913531XP_012826224.3 FReD 33..255 CDD:238040 78/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.