DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and fgl1a

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_002940496.2 Gene:fgl1a / 100486005 XenbaseID:XB-GENE-979409 Length:313 Species:Xenopus tropicalis


Alignment Length:311 Identity:99/311 - (31%)
Similarity:145/311 - (46%) Gaps:55/311 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 ESNLNLSSRLDALATLLASTALSVRSVQVEVANLSRAIRRQSRLIQGKGLRSTPGQQPIFYGPSG 258
            ||.|....||.|...||.:   .|:..|:::.|          |:|.|.|      |.:..|...
 Frog    25 ESCLQEQLRLQAQVRLLEN---QVKVQQIKIQN----------LLQEKEL------QLMDRGDEN 70

  Fly   259 LNGPTATRQLPSSCSYSFLSNH---GILKVQLTPESESFYVSCDED----WTVILSRTSDDVNFE 316
            .....|.:::.:.|:..:...|   ...|::....::|||..||..    |||...|:....||.
 Frog    71 RVINLAEKRVYADCAEIYNDGHKQSAFYKIKPLQSTDSFYAFCDMSEGGGWTVFQRRSDGSQNFN 135

  Fly   317 RGWLDYRDGFGNLA---GDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLFAIGSEKEL 378
            |.|.:|:.|||:..   |::::|.:.||.||....:.||:.:.||.|...:|.|..|::|.|:..
 Frog   136 RNWTEYKQGFGDFTSAKGEYWLGNDNLHYLTLQGDYILRVELVDFEGQRRFAQYKSFSVGDEETS 200

  Fly   379 YPLVLLGKFQDNLTPSAGDSLSYH-----------AGAKFSTVDQDNDNCLECNCALRHKGAGWF 432
            |.: ..|::    |.:||||::..           :|.||||.|:|||| .|.|||...||..||
 Frog   201 YQM-SCGEY----TGTAGDSITAGFNPEVTWWANLSGMKFSTQDRDNDN-YEGNCAEEDKGGWWF 259

  Fly   433 NNCAKSNL-----FGEYTTQNQPGETGIWWDTFSG-QNSLKRVRWMIRPIS 477
            |.|..:||     .|.||::.   :.||.|.|:.| ..|||.|...|||.|
 Frog   260 NRCHAANLNGWYYKGPYTSKT---DDGIVWYTWHGWWYSLKSVTMKIRPAS 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 79/235 (34%)
fgl1aXP_002940496.2 FReD 81..305 CDD:238040 78/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.