DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and LOC100334800

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001315009.1 Gene:LOC100334800 / 100334800 -ID:- Length:246 Species:Danio rerio


Alignment Length:179 Identity:66/179 - (36%)
Similarity:93/179 - (51%) Gaps:9/179 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 WTVILSRTSDDVNFERGWLDYRDGFGNLAGDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAG 366
            ||||..|....:||.|.|.:|:.|||...|:.::||..:|.:|.:..:.||:.:|||.|....|.
Zfish    72 WTVIQKRMDGSLNFYRPWKEYKRGFGTPEGEHWLGLENIHRITRNKKYMLRVDIEDFGGRKGCAH 136

  Fly   367 YSLFAIGSEKELYPLVLLGKFQDNLTPSAGDSLSYHAGAKFSTVDQDNDNCLECNCALRHKGAGW 431
            ||.|::..|::.|.|.:.| |:|.   .||||||.|...||||.|:|.|: .:.|||....|..|
Zfish   137 YSSFSVDCEEDGYKLHVSG-FRDG---GAGDSLSSHNNQKFSTFDKDQDD-YKKNCAREFLGGFW 196

  Fly   432 FNNCAKSNLFGEYTTQNQPGETGI---WWD-TFSGQNSLKRVRWMIRPI 476
            :..|..:|..|.|...:......|   ||. ..:..||||.:...|:.|
Zfish   197 YKKCHHANPNGVYLWGHDRTHYAIGVCWWSWDHNYYNSLKYISMKIKRI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 65/177 (37%)
LOC100334800NP_001315009.1 FReD 28..245 CDD:238040 65/177 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.