DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and mfap4.2

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001103320.1 Gene:mfap4.2 / 100126122 ZFINID:ZDB-GENE-071004-112 Length:242 Species:Danio rerio


Alignment Length:228 Identity:84/228 - (36%)
Similarity:117/228 - (51%) Gaps:27/228 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 LPSSCSYSFLSNHGILKV-QLTPESES-FYVSC-------DED---WTVILSRTSDDVNFERGWL 320
            :|..||..:.|...:..| .:.|..|: .:|.|       ||:   ||||..|....|||.|...
Zfish    22 MPFDCSDIYKSGETLSGVYTIYPAGETPVWVYCQMISDGKDEENGGWTVIQRRMDGSVNFYRPGR 86

  Fly   321 DYRDGFGNLAGDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLFAIGSEKELYPLVLLG 385
            ||:.||||:.|::::||..|:.||......||:.:|||.|...:|.||.|::|.|.|.|.|.:.|
Zfish    87 DYKRGFGNVEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRRGFAQYSSFSVGCECEGYKLQVSG 151

  Fly   386 KFQDNLTPSAGDSLSYHAGAKFSTVDQDNDNCLECNCALRHKGAGWFNNCAKSN-----LFGEYT 445
             |.|.   .||||.|.|.|.||||.|:|.|. .|.|||....||.|::.|..:|     |:.|.:
Zfish   152 -FTDG---GAGDSASTHNGMKFSTFDKDQDT-YEKNCAKEFLGAFWYSACHNANPNGVYLWHEGS 211

  Fly   446 TQNQPGETGIWWDTFSGQN--SLKRVRWMIRPI 476
            |.|   ..|:.|.::.|.|  |:|.:...|:.:
Zfish   212 THN---AIGVSWYSWKGNNAVSMKTISIKIKQV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 84/226 (37%)
mfap4.2NP_001103320.1 FReD 23..239 CDD:238040 83/223 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.