DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and LOC100007488

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001315007.1 Gene:LOC100007488 / 100007488 -ID:- Length:245 Species:Danio rerio


Alignment Length:224 Identity:79/224 - (35%)
Similarity:108/224 - (48%) Gaps:20/224 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 PSSCSYSFLSNHGILKVQLTPESESF--YVSC-------DED---WTVILSRTSDDVNFERGWLD 321
            |..||..:.|...:..:.....:..|  :|.|       |||   ||||..|....|||.|.|.|
Zfish    27 PFDCSDIYKSGQNLSGIYSIYPAGDFPVWVYCQMVSEGKDEDKGGWTVIQRRMDGSVNFYRPWRD 91

  Fly   322 YRDGFGNLAGDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLFAIGSEKELYPLVLLGK 386
            |:.|||.:.|::::||..|:.||......||:.:|||.|...:|.||.|::|.|.|.|.|.:.| 
Zfish    92 YKRGFGKVEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRRGFAQYSSFSVGCECEGYKLQVSG- 155

  Fly   387 FQDNLTPSAGDSLSYHAGAKFSTVDQDNDNCLECNCALRHKGAGWFNNCAKSNLFGEYTTQNQPG 451
            |.|.   .|||.||.|...||||.|:|.|. .|.:||..:.|..|:.:|..:|..|.|.....|.
Zfish   156 FTDG---GAGDCLSGHNDLKFSTFDKDQDT-HEKSCAKEYLGGFWYGSCHNTNPNGVYLWGEDPT 216

  Fly   452 E--TGIWWDTFSGQN-SLKRVRWMIRPIS 477
            .  .|:.|.|:.... |:|.....|:.:|
Zfish   217 HYAIGVCWSTWKNYAVSMKTFSMKIKRVS 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 78/221 (35%)
LOC100007488NP_001315007.1 FReD 25..244 CDD:238040 78/221 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.