DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and fgl1

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_001923586.2 Gene:fgl1 / 100003029 ZFINID:ZDB-GENE-130815-1 Length:307 Species:Danio rerio


Alignment Length:218 Identity:78/218 - (35%)
Similarity:107/218 - (49%) Gaps:39/218 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 SESFY------------VSCD----EDWTVILSRTSDDVNFERGWLDYRDGFGNLA---GDFFIG 336
            |..||            |.||    ..||:...|:...::|:|.|.||:.|||::.   |:|::|
Zfish    88 SSGFYMIKPLRSPTRVRVFCDMTEGGGWTLFQRRSDGSLSFDRDWNDYKIGFGDMKSANGEFWLG 152

  Fly   337 LNKLHALTSSALHELRIVMEDFSGNVAYAGYSLFAIGSEKELYPLVLLGKFQDNLTPSAGDSLS- 400
            .:.||.|||...:.|||.:|||.|...:|.|..|.:.:|::.|.| ..|.:    :.:|||:|| 
Zfish   153 NDNLHYLTSQGDYTLRINLEDFEGTHRFAVYRNFKVDNEEKHYQL-QFGMY----SGTAGDALSG 212

  Fly   401 ----------YHAGAKFSTVDQDNDNCLECNCALRHKGAGWFNNCAKSNLFGEYTTQNQPGET-- 453
                      .|.|.||||.|:|:|. .:.|||...||..|||.|..:||.|.|........|  
Zfish   213 SFHPEVQWWASHQGMKFSTRDRDHDR-YDRNCAQEDKGGWWFNRCHSANLNGFYHRGAYSASTDD 276

  Fly   454 GIWWDTFSG-QNSLKRVRWMIRP 475
            ||.|..:.| ..|||.|:..|||
Zfish   277 GIVWYPWHGWWYSLKSVQMKIRP 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 78/218 (36%)
fgl1XP_001923586.2 FReD 74..299 CDD:238040 76/216 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.