DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63E and CDK1

DIOPT Version :9

Sequence 1:NP_001261373.1 Gene:Eip63E / 38433 FlyBaseID:FBgn0005640 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001307847.1 Gene:CDK1 / 983 HGNCID:1722 Length:297 Species:Homo sapiens


Alignment Length:307 Identity:145/307 - (47%)
Similarity:195/307 - (63%) Gaps:21/307 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 EAYVKLEPLGEGSYATVYKGFSKLTYQRVALKEIRLQ-EEEGAPFTAIREASLLKELKHSNIVTL 266
            |.|.|:|.:|||:|..||||..|.|.|.||:|:|||: ||||.|.|||||.||||||:|.|||:|
Human     2 EDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSL 66

  Fly   267 HDIVHTRETLTFVFEYVNTDLSQYMEKHPGG--LDHRNVRLFLFQLLRGLSYCHKRRVLHRDVKP 329
            .|::.....|..:||:::.||.:|::..|.|  :|...|:.:|:|:|:|:.:||.|||||||:||
Human    67 QDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKP 131

  Fly   330 QNLLISDCGELKLADFGLARAKSVPSHTYSHEVVTLWYRPPDVLLGSTEYSTSLDMWGVGCIFVE 394
            |||||.|.|.:||||||||||..:|...|:|||||||||.|:|||||..|||.:|:|.:|.||.|
Human   132 QNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAE 196

  Fly   395 MVTGMPTFPGIRDTYDQLDKIFKLLGTPTEDTWPGV-------THFPGYKPHKLGFYRPRKLGHN 452
            :.|..|.|.|..: .|||.:||:.||||..:.||.|       ..||.:||..|..: .:.|..|
Human   197 LATKKPLFHGDSE-IDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASH-VKNLDEN 259

  Fly   453 FPRLYDIIEGETIANGFLQLNPEQRLGADDALQHPYFAQLPKKLYEL 499
                     |..:.:..|..:|.:|:....||.||||..|..::.::
Human   260 ---------GLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63ENP_001261373.1 PLN00009 203..492 CDD:177649 144/298 (48%)
STKc_PCTAIRE_like 204..489 CDD:270835 141/294 (48%)
CDK1NP_001307847.1 STKc_CDK1_euk 3..287 CDD:270845 141/294 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.