DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63E and Cdk4

DIOPT Version :9

Sequence 1:NP_001261373.1 Gene:Eip63E / 38433 FlyBaseID:FBgn0005640 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_038935924.1 Gene:Cdk4 / 94201 RGDID:621120 Length:313 Species:Rattus norvegicus


Alignment Length:239 Identity:97/239 - (40%)
Similarity:130/239 - (54%) Gaps:30/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 VTLHDIVHTRET-----LTFVFEYVNTDLSQYMEK-HPGGLDHRNVRLFLFQLLRGLSYCHKRRV 322
            |.|.|:..|..|     :|.|||:::.||..|::| .|.||....::..:.|.|.||.:.|...:
  Rat    82 VRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDLMRQFLSGLDFLHANCI 146

  Fly   323 LHRDVKPQNLLISDCGELKLADFGLARAKSVPSHTYSHE------VVTLWYRPPDVLLGSTEYST 381
            :|||:||:|:|::..|.:|||||||||       .||::      |||||||.|:|||.|| |:|
  Rat   147 VHRDLKPENILVTSNGTVKLADFGLAR-------IYSYQMALTPVVVTLWYRAPEVLLQST-YAT 203

  Fly   382 SLDMWGVGCIFVEMVTGMPTFPGIRDTYDQLDKIFKLLGTPTEDTWPGVTHFP--GYKPHKLGFY 444
            .:|||.|||||.||....|.|.|..:. |||.|||.|:|.|.||.||.....|  .:.|.     
  Rat   204 PVDMWSVGCIFAEMFRRKPLFCGNSEA-DQLGKIFDLIGLPPEDDWPREVSLPRGAFSPR----- 262

  Fly   445 RPRKLGHNFPRLYDIIEGETIANGFLQLNPEQRLGADDALQHPY 488
            .||.:....|.:.:  .|..:....|..||.:|:.|..||||.|
  Rat   263 GPRPVQSVVPEMEE--SGAQLLLEMLTFNPLKRISAFRALQHSY 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63ENP_001261373.1 PLN00009 203..492 CDD:177649 97/239 (41%)
STKc_PCTAIRE_like 204..489 CDD:270835 97/239 (41%)
Cdk4XP_038935924.1 PKc_like <82..305 CDD:419665 97/239 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.