DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63E and CDC28

DIOPT Version :9

Sequence 1:NP_001261373.1 Gene:Eip63E / 38433 FlyBaseID:FBgn0005640 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_009718.3 Gene:CDC28 / 852457 SGDID:S000000364 Length:298 Species:Saccharomyces cerevisiae


Alignment Length:301 Identity:145/301 - (48%)
Similarity:186/301 - (61%) Gaps:15/301 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 GKQEAYVKLEPLGEGSYATVYKGFSKLTYQR---VALKEIRLQ-EEEGAPFTAIREASLLKELKH 260
            |:...|.:||.:|||:|..|||.......|.   ||||:|||: |:||.|.|||||.|||||||.
Yeast     3 GELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREISLLKELKD 67

  Fly   261 SNIVTLHDIVHT-RETLTFVFEYVNTDLSQYME----KHPGGLDHRNVRLFLFQLLRGLSYCHKR 320
            .|||.|:||||: ...|..|||:::.||.:|||    ..|.|.|  .|:.|:.||.:|::|||..
Yeast    68 DNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGAD--IVKKFMMQLCKGIAYCHSH 130

  Fly   321 RVLHRDVKPQNLLISDCGELKLADFGLARAKSVPSHTYSHEVVTLWYRPPDVLLGSTEYSTSLDM 385
            |:||||:|||||||:..|.|||.|||||||..||...|:||:||||||.|:||||..:|||.:|.
Yeast   131 RILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDT 195

  Fly   386 WGVGCIFVEMVTGMPTFPGIRDTYDQLDKIFKLLGTPTEDTWPGVTHFPGYKPHKLGFYRPRKLG 450
            |.:||||.||....|.|.|..: .||:.|||::||||.|..||.:.:.|.:|| ....:|.:.|.
Yeast   196 WSIGCIFAEMCNRKPIFSGDSE-IDQIFKIFRVLGTPNEAIWPDIVYLPDFKP-SFPQWRRKDLS 258

  Fly   451 HNFPRLYDIIEGETIANGFLQLNPEQRLGADDALQHPYFAQ 491
            ...|.|..  .|..:.:..|..:|..|:.|..|..||||.:
Yeast   259 QVVPSLDP--RGIDLLDKLLAYDPINRISARRAAIHPYFQE 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63ENP_001261373.1 PLN00009 203..492 CDD:177649 144/298 (48%)
STKc_PCTAIRE_like 204..489 CDD:270835 142/293 (48%)
CDC28NP_009718.3 STKc_CDK1_CdkB_like 8..295 CDD:270829 142/292 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.