DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63E and CDKB2;1

DIOPT Version :9

Sequence 1:NP_001261373.1 Gene:Eip63E / 38433 FlyBaseID:FBgn0005640 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_177780.1 Gene:CDKB2;1 / 843987 AraportID:AT1G76540 Length:313 Species:Arabidopsis thaliana


Alignment Length:304 Identity:126/304 - (41%)
Similarity:186/304 - (61%) Gaps:16/304 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 EAYVKLEPLGEGSYATVYKGFSKLTYQRVALKEIRLQE-EEGAPFTAIREASLLKEL-KHSNIVT 265
            :|:.|||.:|||:|..||:...|.|.:.||||:.||.| |||.|.|.:||.|:|:.| :..::|.
plant    12 DAFEKLEKVGEGTYGKVYRAREKATGKIVALKKTRLHEDEEGVPSTTLREISILRMLARDPHVVR 76

  Fly   266 LHDI-----VHTRETLTFVFEYVNTDLSQYMEKHPG---GLDHRNVRLFLFQLLRGLSYCHKRRV 322
            |.|:     ...:..|..||||::||:.:::.....   .:..:.::..::||.:|:::||...:
plant    77 LMDVKQGLSKEGKTVLYLVFEYMDTDVKKFIRSFRSTGKNIPTQTIKSLMYQLCKGMAFCHGHGI 141

  Fly   323 LHRDVKPQNLLIS-DCGELKLADFGLARAKSVPSHTYSHEVVTLWYRPPDVLLGSTEYSTSLDMW 386
            ||||:||.|||:. ....||:||.|||||.::|...|:||::|||||.|:||||:|.|||::|||
plant   142 LHRDLKPHNLLMDPKTMRLKIADLGLARAFTLPMKKYTHEILTLWYRAPEVLLGATHYSTAVDMW 206

  Fly   387 GVGCIFVEMVTGMPTFPGIRDTYDQLDKIFKLLGTPTEDTWPGVTHFPGYKPHKLGFYRPRKLGH 451
            .|||||.|:||....|.|..: ..||..||||.|||.|:.||||:....:  |:...::|..|..
plant   207 SVGCIFAELVTNQAIFQGDSE-LQQLLHIFKLFGTPNEEMWPGVSTLKNW--HEYPQWKPSTLSS 268

  Fly   452 NFPRLYDIIEGETIANGFLQLNPEQRLGADDALQHPYFAQLPKK 495
            ..|.|.:  .|..:.:..||..|.:|:.|..|::||||..||:|
plant   269 AVPNLDE--AGVDLLSKMLQYEPAKRISAKMAMEHPYFDDLPEK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63ENP_001261373.1 PLN00009 203..492 CDD:177649 123/299 (41%)
STKc_PCTAIRE_like 204..489 CDD:270835 121/295 (41%)
CDKB2;1NP_177780.1 PKc_like 12..305 CDD:419665 122/297 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.