DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63E and CDKB2;2

DIOPT Version :9

Sequence 1:NP_001261373.1 Gene:Eip63E / 38433 FlyBaseID:FBgn0005640 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_173517.1 Gene:CDKB2;2 / 838687 AraportID:AT1G20930 Length:315 Species:Arabidopsis thaliana


Alignment Length:304 Identity:132/304 - (43%)
Similarity:186/304 - (61%) Gaps:16/304 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 EAYVKLEPLGEGSYATVYKGFSKLTYQRVALKEIRLQE-EEGAPFTAIREASLLKEL-KHSNIVT 265
            ||:.|||.:|||:|..||:...|.|...||||:.||.| |||.|.|.:||.|:|:.| :..:||.
plant    14 EAFEKLEKVGEGTYGKVYRAREKATGMIVALKKTRLHEDEEGVPPTTLREISILRMLARDPHIVR 78

  Fly   266 LHDI-----VHTRETLTFVFEYVNTDLSQYME--KHPG-GLDHRNVRLFLFQLLRGLSYCHKRRV 322
            |.|:     ...:..|..|||||:|||.:::.  :..| .:....|:..::||.:|:::||...|
plant    79 LMDVKQGINKEGKTVLYLVFEYVDTDLKKFIRSFRQAGQNIPQNTVKCLMYQLCKGMAFCHGHGV 143

  Fly   323 LHRDVKPQNLLIS-DCGELKLADFGLARAKSVPSHTYSHEVVTLWYRPPDVLLGSTEYSTSLDMW 386
            ||||:||.|||:. ....||:||.|||||.::|...|:||::|||||.|:||||:|.|||.:|||
plant   144 LHRDLKPHNLLMDRKTMTLKIADLGLARAFTLPMKKYTHEILTLWYRAPEVLLGATHYSTGVDMW 208

  Fly   387 GVGCIFVEMVTGMPTFPGIRDTYDQLDKIFKLLGTPTEDTWPGVTHFPGYKPHKLGFYRPRKLGH 451
            .|||||.|:||....|.|..: ..||.:||:|||||.|:.||||:....:  |:...::|..|..
plant   209 SVGCIFAELVTKQAIFAGDSE-LQQLLRIFRLLGTPNEEVWPGVSKLKDW--HEYPQWKPLSLST 270

  Fly   452 NFPRLYDIIEGETIANGFLQLNPEQRLGADDALQHPYFAQLPKK 495
            ..|.|.:  .|..:.:..|:..|.:|:.|..|::||||..||.|
plant   271 AVPNLDE--AGLDLLSKMLEYEPAKRISAKKAMEHPYFDDLPDK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63ENP_001261373.1 PLN00009 203..492 CDD:177649 129/299 (43%)
STKc_PCTAIRE_like 204..489 CDD:270835 126/295 (43%)
CDKB2;2NP_173517.1 PKc_like 14..307 CDD:389743 128/297 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.