DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63E and ORG1

DIOPT Version :9

Sequence 1:NP_001261373.1 Gene:Eip63E / 38433 FlyBaseID:FBgn0005640 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_851182.1 Gene:ORG1 / 835426 AraportID:AT5G53450 Length:670 Species:Arabidopsis thaliana


Alignment Length:214 Identity:45/214 - (21%)
Similarity:75/214 - (35%) Gaps:71/214 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 RNVRLFLFQLLRGLSYCHKRRVLHRDVKPQNLLISDCG-ELKL------ADFGLARAKSVPSHTY 358
            |.:|..:..:|.|::|.|...:.|.:::.:|:.||... .:|:      |||.    ..|||   
plant   230 RLIRTLMRDILIGVNYLHSHGLAHTELRLENVHISPVDRHIKVGILGNAADFN----GDVPS--- 287

  Fly   359 SHEVVTLWYRPPDVLLGSTEYST--------SLDMWGVGCIFVEMV----------TGMPTFPGI 405
                            .|..|||        :.||..||.:..:||          ..:.:|...
plant   288 ----------------TSNAYSTMDRRQMMIAFDMRCVGFMMAKMVLQELMDPLIFAKLKSFLAK 336

  Fly   406 RDTYDQLDKIF-KLLGTPTEDTWPGVTHFPGYKPHKLGFYRPRKLGHNFPRLYDIIEGETIANGF 469
            .:....|.:.| ..|.|.:|....||                :.|..|:.      .|..:.:..
plant   337 GNDPSSLREFFVTTLNTNSESGNTGV----------------QILDRNWG------AGWHLLSLL 379

  Fly   470 LQLNPEQRLGADDALQHPY 488
            :...|.:|:...|||:||:
plant   380 IATRPSERISCLDALKHPF 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63ENP_001261373.1 PLN00009 203..492 CDD:177649 45/214 (21%)
STKc_PCTAIRE_like 204..489 CDD:270835 45/214 (21%)
ORG1NP_851182.1 PKc_like 106..399 CDD:419665 45/214 (21%)
PAP_fibrillin 434..587 CDD:309752
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.