DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63E and CDKB1;1

DIOPT Version :9

Sequence 1:NP_001261373.1 Gene:Eip63E / 38433 FlyBaseID:FBgn0005640 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_190986.1 Gene:CDKB1;1 / 824585 AraportID:AT3G54180 Length:309 Species:Arabidopsis thaliana


Alignment Length:313 Identity:143/313 - (45%)
Similarity:190/313 - (60%) Gaps:23/313 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 EAYVKLEPLGEGSYATVYKGFSKLTYQRVALKEIRLQ-EEEGAPFTAIREASLLKELKHS-NIVT 265
            |.|.|||.:|||:|..|||...|.|.:.||||:.||: :|||.|.||:||.|||:.|..| .:|.
plant     2 EKYEKLEKVGEGTYGKVYKAMEKGTGKLVALKKTRLEMDEEGIPPTALREISLLQMLSTSIYVVR 66

  Fly   266 LHDIVH----------TRETLTFVFEYVNTDLSQYMEKHPGGLDHRNVRLFL-----FQLLRGLS 315
            |..:.|          |:..|..||||::|||.::::.:..|.:.:.:..||     |||.:|::
plant    67 LLCVEHVHQPSTKSQSTKSNLYLVFEYLDTDLKKFIDSYRKGPNPKPLEPFLIQKLMFQLCKGVA 131

  Fly   316 YCHKRRVLHRDVKPQN-LLISDCGELKLADFGLARAKSVPSHTYSHEVVTLWYRPPDVLLGSTEY 379
            :||...|||||:|||| ||:.|...||:||.||.||.:||..:|:||:||||||.|:||||||.|
plant   132 HCHSHGVLHRDLKPQNLLLVKDKELLKIADLGLGRAFTVPLKSYTHEIVTLWYRAPEVLLGSTHY 196

  Fly   380 STSLDMWGVGCIFVEMVTGMPTFPGIRDTYDQLDKIFKLLGTPTEDTWPGVTHFPGYKPHKLGFY 444
            ||.:|||.|||||.|||.....|||..: :.||..||:|||||||..||||:....:  |....:
plant   197 STGVDMWSVGCIFAEMVRRQALFPGDSE-FQQLLHIFRLLGTPTEQQWPGVSTLRDW--HVYPKW 258

  Fly   445 RPRKLGHNFPRLYDIIEGETIANGFLQLNPEQRLGADDALQHPYFAQLPKKLY 497
            .|:.|....|.|..  :|..:....|:.||.:|:.|..||.||||..|.|..:
plant   259 EPQDLTLAVPSLSP--QGVDLLTKMLKYNPAERISAKTALDHPYFDSLDKSQF 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63ENP_001261373.1 PLN00009 203..492 CDD:177649 141/306 (46%)
STKc_PCTAIRE_like 204..489 CDD:270835 138/302 (46%)
CDKB1;1NP_190986.1 PKc_like 2..302 CDD:419665 140/304 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.