DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63E and Cdkl3

DIOPT Version :9

Sequence 1:NP_001261373.1 Gene:Eip63E / 38433 FlyBaseID:FBgn0005640 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_008772105.1 Gene:Cdkl3 / 60396 RGDID:619874 Length:648 Species:Rattus norvegicus


Alignment Length:322 Identity:104/322 - (32%)
Similarity:166/322 - (51%) Gaps:19/322 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 DSPFGKQEAYVKLEPLGEGSYATVYKGFSKLTYQRVALKEIRLQEEEGAPFTAIREASLLKELKH 260
            :.|..|.|.|..|..:|||||.||.|...|.|.:.||:|....:.|:.....|.||...||:.:|
  Rat     7 EKPGLKMEMYETLGKVGEGSYGTVMKCKHKDTGRIVAIKIFYEKPEKSVNKIATREIKFLKQFRH 71

  Fly   261 SNIVTLHDIVHTRETLTFVFEYVNTDLSQYMEKHPGGLDHRNVRLFLFQLLRGLSYCHKRRVLHR 325
            .|:|.|.::...::.:..|||:::..:...::.:..||:.:.:|.:|||:||.:.|.|...::||
  Rat    72 ENLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHGLESKRLRKYLFQILRAIEYLHNNNIIHR 136

  Fly   326 DVKPQNLLISDCGELKLADFGLARAKSVPSHTYSHEVVTLWYRPPDVLLGSTEYSTSLDMWGVGC 390
            |:||:|:|:|..|..||.|||.||..:.|...|:..|.|.|||.|:::|..|.|...:|:|.:||
  Rat   137 DIKPENILVSQSGITKLCDFGFARTLAAPGDVYTDYVATRWYRAPELVLKDTTYGKPVDIWALGC 201

  Fly   391 IFVEMVTGMPTFPGIRDTYDQLDKIFKLLGTPTEDTWPGVTHFPGYKPHKLG-----FYRPRKLG 450
            :.:||.||.|..|...| .|.|.||...:|..|    |.:.:.....|...|     ...|:...
  Rat   202 MIIEMATGNPYLPSSSD-LDLLHKIVLKVGNLT----PHLHNIFSKSPIFAGVVLPQVQHPKNAR 261

  Fly   451 HNFPRLYDIIEGETIANGFLQLNPEQRLGADDALQHPYFAQ-------LPKKLYELPDETSI 505
            ..:|:|..::  ..|.:..||::|.:|:.:.|.|.|.||.:       :|:...:|..|..:
  Rat   262 KKYPKLNGLL--ADIVHACLQIDPAERISSTDLLHHDYFTRDGFIEKFIPELRAKLLQEAKV 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63ENP_001261373.1 PLN00009 203..492 CDD:177649 99/300 (33%)
STKc_PCTAIRE_like 204..489 CDD:270835 96/289 (33%)
Cdkl3XP_008772105.1 PKc_like 14..298 CDD:304357 97/290 (33%)
S_TKc 16..298 CDD:214567 96/288 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.