DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63E and cdk21

DIOPT Version :9

Sequence 1:NP_001261373.1 Gene:Eip63E / 38433 FlyBaseID:FBgn0005640 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_005164229.1 Gene:cdk21 / 569515 ZFINID:ZDB-GENE-131121-149 Length:305 Species:Danio rerio


Alignment Length:309 Identity:115/309 - (37%)
Similarity:166/309 - (53%) Gaps:44/309 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 YVKLEPLGEGSYATVYKGFSKLTYQR-VALKEIRLQE--EEGAPFTAIREASLLKELK---HSNI 263
            |..|..:|:|:|..|||...|...|| :|:|.:.:.|  |.|.|...|||.:||::::   |.||
Zfish    11 YEILAEIGQGAYGKVYKAREKREQQRLIAVKRLNIPEEPESGIPQFMIREVALLRKIEHFNHPNI 75

  Fly   264 VTLHDI----VHTRETLTFVFEYVNTDLSQYMEK-HPGGLDHRNVRLFLFQLLRGLSYCHKRRVL 323
            |.|..:    .:.:..:|.||||::.||:.::.: ...||....::..:.|||.||.:.|...|:
Zfish    76 VKLMSVSAGWQNHKFDMTLVFEYIDQDLTTFLSRASEKGLAKDKIKDVMRQLLSGLDFLHTNSVI 140

  Fly   324 HRDVKPQNLLISDCGELKLADFGLARAKSVPSHTY----SHEVVTLWYRPPDVLLGSTEYSTSLD 384
            |||:||.|:|:|..||:|:|||||||.     :||    :..|||||||.|:|||.|: |.:|:|
Zfish   141 HRDLKPDNVLVSSRGEVKIADFGLARI-----YTYRIALTPCVVTLWYRAPEVLLQSS-YMSSVD 199

  Fly   385 MWGVGCIFVEMVTGMPTFPGIRDTYDQLDKIFKLLGTPTEDTWP---GVTHFPGYKPHK-----L 441
            ||..||||.|:....|.|.|..: ..||.|||:::|.|.::.||   .|.:.|.....|     |
Zfish   200 MWSAGCIFAELFLLRPLFRGFTE-IQQLQKIFEVIGLPGKEDWPVESPVCYSPALVEKKPATQVL 263

  Fly   442 GFYRPRKLGHNFPRLYDIIEGETIANGFLQLNPEQRLGADDALQHPYFA 490
            ....|.:.|              :.:.||..||..|:.|.:||.|||.|
Zfish   264 ASLTPEENG--------------LLSQFLAFNPVHRISACEALAHPYLA 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63ENP_001261373.1 PLN00009 203..492 CDD:177649 115/309 (37%)
STKc_PCTAIRE_like 204..489 CDD:270835 113/306 (37%)
cdk21XP_005164229.1 STKc_CDK4_6_like 11..297 CDD:270831 113/306 (37%)
S_TKc 11..297 CDD:214567 113/306 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.