DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63E and Cdk4

DIOPT Version :9

Sequence 1:NP_001261373.1 Gene:Eip63E / 38433 FlyBaseID:FBgn0005640 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster


Alignment Length:337 Identity:125/337 - (37%)
Similarity:177/337 - (52%) Gaps:48/337 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 LNKQETHPRRKRFSAFGGDSPFGKQEAYVKLEPLGEGSYATVYKGFSKLTYQRVALKEIRLQ-EE 241
            |.:|:....:|    ||...||..||    |..:|||:|.|||:....:|...||||::|:. .|
  Fly     7 LKRQKMSQAKK----FGDGDPFNYQE----LNIIGEGAYGTVYRARDVITGNIVALKKVRISLNE 63

  Fly   242 EGAPFTAIREASLLKEL---KHSNIVTLHDIVHTRE-----TLTFVFEYVNTDLSQYMEKHP-GG 297
            .|.|.:.:||.||||:|   .|:|||.|:::....|     .:..|||:|..|||..:::.| .|
  Fly    64 NGVPMSTLREISLLKQLNASNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSG 128

  Fly   298 LDHRNVRLFLFQLLRGLSYCHKRRVLHRDVKPQNLLISDCGELKLADFGLARAKSVPSHTYSHE- 361
            :....::....:||.|:.:.|..|::|||:||||||:|..|.||:||||||:       ||..| 
  Fly   129 MSPPTIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSSQGHLKIADFGLAK-------TYGSEM 186

  Fly   362 -----VVTLWYRPPDVLLGSTEYSTSLDMWGVGCIFVEMVTGMPTFPGIRDTYDQLDKIFKLLGT 421
                 |||||||.|:||| :..|::::|:|...||..||......|||..:. :|||:||:|.|.
  Fly   187 KLTSVVVTLWYRAPEVLL-AQPYNSTVDIWSAACIIFEMFNRRALFPGTSEK-NQLDRIFELTGR 249

  Fly   422 PTEDTWP-----GVTHFPGYKPHKLGFYRPRKLGHNFPRLYDIIEGETIANGFLQLNPEQRLGAD 481
            |||..||     .:.|||...|.     ||:....:..:..|     .:.|..|..:...|..|.
  Fly   250 PTEQQWPQTISVALEHFPQRHPK-----RPKDFCPHLCKYAD-----DLLNKMLSYDLHLRPSAL 304

  Fly   482 DALQHPYFAQLP 493
            ..|:|.||.|.|
  Fly   305 ACLEHDYFQQEP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63ENP_001261373.1 PLN00009 203..492 CDD:177649 115/309 (37%)
STKc_PCTAIRE_like 204..489 CDD:270835 112/305 (37%)
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 114/308 (37%)
S_TKc 26..312 CDD:214567 114/308 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442438
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.