DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63E and Cdk1

DIOPT Version :9

Sequence 1:NP_001261373.1 Gene:Eip63E / 38433 FlyBaseID:FBgn0005640 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster


Alignment Length:303 Identity:139/303 - (45%)
Similarity:191/303 - (63%) Gaps:33/303 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 EAYVKLEPLGEGSYATVYKGFSKLTYQRVALKEIRLQ-EEEGAPFTAIREASLLKELKHSNIVTL 266
            |.:.|:|.:|||:|..||||.::||.|.||:|:|||: ::||.|.|||||.||||||||.|||.|
  Fly     2 EDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVCL 66

  Fly   267 HDIVHTRETLTFVFEYVNTDLSQYM-----EKHPGGLDHRNVRLFLFQLLRGLSYCHKRRVLHRD 326
            .|::.....:..:||:::.||.:||     :||   ::...||.:|:|:...:.:||:|||||||
  Fly    67 EDVLMEENRIYLIFEFLSMDLKKYMDSLPVDKH---MESELVRSYLYQITSAILFCHRRRVLHRD 128

  Fly   327 VKPQNLLISDCGELKLADFGLARAKSVPSHTYSHEVVTLWYRPPDVLLGSTEYSTSLDMWGVGCI 391
            :|||||||...|.:|:|||||.|:..:|...|:||:||||||.|:|||||..||..:|:|.:|||
  Fly   129 LKPQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCI 193

  Fly   392 FVEMVTGMPTFPGIRDTYDQLDKIFKLLGTPTEDTWPGVTHFPGYKPHKLGFYRPRKLGHNFP-- 454
            |.||.|..|.|.|..: .|||.::|::|.|||||.|||||..|.||             :.||  
  Fly   194 FAEMATRKPLFQGDSE-IDQLFRMFRILKTPTEDIWPGVTSLPDYK-------------NTFPCW 244

  Fly   455 -------RLYDI-IEGETIANGFLQLNPEQRLGADDALQHPYF 489
                   :|.:: ..|..:....|..:|..|:.|.|.|:||||
  Fly   245 STNQLTNQLKNLDANGIDLIQKMLIYDPVHRISAKDILEHPYF 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63ENP_001261373.1 PLN00009 203..492 CDD:177649 139/303 (46%)
STKc_PCTAIRE_like 204..489 CDD:270835 136/300 (45%)
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 136/300 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442440
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.