DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63E and Cdk7

DIOPT Version :9

Sequence 1:NP_001261373.1 Gene:Eip63E / 38433 FlyBaseID:FBgn0005640 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_511044.1 Gene:Cdk7 / 31441 FlyBaseID:FBgn0263237 Length:353 Species:Drosophila melanogaster


Alignment Length:351 Identity:131/351 - (37%)
Similarity:186/351 - (52%) Gaps:33/351 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 KQEAYVKLEPLGEGSYATVYKGFSKLTYQRVALKEI----RLQEEEGAPFTAIREASLLKELKHS 261
            |.|.|.||..||||.:|||||....:|.|.||:|:|    |....:|...||:||..:|:||:|.
  Fly     8 KTERYAKLSFLGEGQFATVYKARDTVTNQIVAVKKIKKGSREDARDGINRTALREIKILQELQHE 72

  Fly   262 NIVTLHDIVHTRETLTFVFEYVNTDLSQYMEKHPGGLDHRNVRLFLFQLLRGLSYCHKRRVLHRD 326
            ||:.|.|:......::.||::::|||...::.:...|...|::.:....|:||.|.|...:||||
  Fly    73 NIIGLVDVFGQLSNVSLVFDFMDTDLEVIIKDNKIILTQANIKAYAIMTLKGLEYLHLNWILHRD 137

  Fly   327 VKPQNLLISDCGELKLADFGLARAKSVPSHTYSHEVVTLWYRPPDVLLGSTEYSTSLDMWGVGCI 391
            :||.|||::..|.||:.|||||::...|:..|:|.|||.|||.|::|.|:.:|.|.:|||.||||
  Fly   138 LKPNNLLVNSDGILKIGDFGLAKSFGSPNRIYTHHVVTRWYRSPELLFGARQYGTGVDMWAVGCI 202

  Fly   392 FVEMVTGMPTFPGIRDTYDQLDKIFKLLGTPTEDTWPGVT---------HFPGYKPHKLGFYRPR 447
            ..|::..:|..||..| .|||.:||..||||||..||.::         :|||.....:......
  Fly   203 LAELMLRVPFMPGDSD-LDQLTRIFSTLGTPTEAEWPHLSKLHDYLQFRNFPGTPLDNIFTAAGN 266

  Fly   448 KLGHNFPRLYDIIEGETIANGFLQLNPEQRLGADDALQHPYFAQLPKKLY--ELPDETSIFTV-E 509
            .|.|...||:             .:||.:|:...:||..||||..|....  :||..::|... |
  Fly   267 DLIHLMQRLF-------------AMNPLRRVSCREALSMPYFANKPAPTVGPKLPMPSAILAAKE 318

  Fly   510 GVQLYTEPNRQNKXKLKQVLSVDGVR 535
            |....|   ...| .||:.|....||
  Fly   319 GANPQT---GDTKPALKRKLVETTVR 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63ENP_001261373.1 PLN00009 203..492 CDD:177649 117/301 (39%)
STKc_PCTAIRE_like 204..489 CDD:270835 113/297 (38%)
Cdk7NP_511044.1 PTZ00024 6..308 CDD:240233 119/313 (38%)
STKc_CDK7 11..308 CDD:270833 117/310 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442386
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.