DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63E and Cdkl2

DIOPT Version :9

Sequence 1:NP_001261373.1 Gene:Eip63E / 38433 FlyBaseID:FBgn0005640 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_006250799.1 Gene:Cdkl2 / 305242 RGDID:1309625 Length:568 Species:Rattus norvegicus


Alignment Length:380 Identity:118/380 - (31%)
Similarity:183/380 - (48%) Gaps:72/380 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 EAYVKLEPLGEGSYATVYKGFSKLTYQRVALKE-IRLQEEEGAPFTAIREASLLKELKHSNIVTL 266
            |.|..|..:|||||..|.|..:|.:.:.||:|: :...:::.....|:||..|||:|:|.|:|.|
  Rat     2 EKYENLGLVGEGSYGMVMKCRNKDSGRIVAIKKFLESDDDKMVKKIAMREIKLLKQLRHENLVNL 66

  Fly   267 HDIVHTRETLTFVFEYVNTDLSQYMEKHPGGLDHRNVRLFLFQLLRGLSYCHKRRVLHRDVKPQN 331
            .::...::....|||:|:..:...::..|.|||::.|:.:|||::.|:.:||...::|||:||:|
  Rat    67 LEVCKKKKRWYLVFEFVDHTILDDLKLFPNGLDYQVVQKYLFQIINGIGFCHSHNIIHRDIKPEN 131

  Fly   332 LLISDCGELKLADFGLARAKSVPSHTYSHEVVTLWYRPPDVLLGSTEYSTSLDMWGVGCIFVEMV 396
            :|:|..|.:||.|||.||..:.|...|:..|.|.|||.|::|:|..:|..::|:|.:||:.:||:
  Rat   132 ILVSQSGVVKLCDFGFARTLAAPGEVYTDYVATRWYRAPELLVGDVKYGKAVDIWAIGCLVIEML 196

  Fly   397 TGMPTFPGIRDTYDQLDKIFKLLGT--PTEDTWPGVTHFPGYKPHKLGFYR-PRKLGHNFPRLYD 458
            .|.|.|||..| .|||..|...||.  |.               |:..||: |...|...|.:.|
  Rat   197 MGQPLFPGESD-IDQLHHIMTCLGNLIPR---------------HQELFYKNPVFAGVRLPEIKD 245

  Fly   459 IIEGE--------------TIANGFLQLNPEQRLGADDALQHPYFA------------------- 490
             ||.|              ::|...|.::|::|....|.|.|.:|.                   
  Rat   246 -IEAEPLESRYPKLPEVVISLAKKCLHIDPDKRPLCADLLHHDFFQMDGFAERFSQELQLKIEKD 309

  Fly   491 ----QLPKKLY--------ELPDETSIFTVEGVQLYTEPNRQNKXKLKQVLSVDG 533
                .||||..        .|.:|.....|:      :.|...|.|..:||.|.|
  Rat   310 ARNNSLPKKFQIRKKEKDDALGEERKTLVVQ------DTNADPKTKDSKVLKVKG 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63ENP_001261373.1 PLN00009 203..492 CDD:177649 104/329 (32%)
STKc_PCTAIRE_like 204..489 CDD:270835 102/302 (34%)
Cdkl2XP_006250799.1 STKc_CDKL2_3 2..289 CDD:270836 103/303 (34%)
S_TKc 4..289 CDD:214567 102/301 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.