DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63E and Cdk6

DIOPT Version :9

Sequence 1:NP_001261373.1 Gene:Eip63E / 38433 FlyBaseID:FBgn0005640 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001178790.1 Gene:Cdk6 / 114483 RGDID:621121 Length:326 Species:Rattus norvegicus


Alignment Length:317 Identity:130/317 - (41%)
Similarity:177/317 - (55%) Gaps:33/317 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 DSPFGKQEAYVKLEPLGEGSYATVYKGFSKLTYQR-VALKEIRLQE-EEGAPFTAIREASLLKEL 258
            ||.....:.|..:..:|||:|..|:|........| ||||.:|:|. |||.|.:.|||.::|:.|
  Rat     4 DSLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHL 68

  Fly   259 ---KHSNIVTLHDIVHT----RET-LTFVFEYVNTDLSQYMEKHP-GGLDHRNVRLFLFQLLRGL 314
               :|.|:|.|.|:...    ||| ||.|||:|:.||:.|::|.| .|:....::..:|||||||
  Rat    69 ETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGL 133

  Fly   315 SYCHKRRVLHRDVKPQNLLISDCGELKLADFGLARAKSVPSHTYSHE------VVTLWYRPPDVL 373
            .:.|..||:|||:||||:|::..|::|||||||||       .||.:      |||||||.|:||
  Rat   134 DFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLAR-------IYSFQMALTSVVVTLWYRAPEVL 191

  Fly   374 LGSTEYSTSLDMWGVGCIFVEMVTGMPTFPGIRDTYDQLDKIFKLLGTPTEDTWPGVTHFPGYKP 438
            |.|: |:|.:|:|.|||||.|:....|.|.|..|. |||.||..::|.|.|:.||.....|....
  Rat   192 LQSS-YATPVDLWSVGCIFAELFRRKPLFRGSSDV-DQLGKILDVIGLPGEEDWPRDVALPRQAF 254

  Fly   439 HKLGFYRPRKLGHNFPRLYDIIE-GETIANGFLQLNPEQRLGADDALQHPYFAQLPK 494
            |........|.      :.||.| |:.:....|..||.:|:.|..||.||||..|.:
  Rat   255 HSKSAQPIEKF------VTDIDELGKDLLLKCLTFNPAKRISAYGALNHPYFQDLER 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63ENP_001261373.1 PLN00009 203..492 CDD:177649 127/306 (42%)
STKc_PCTAIRE_like 204..489 CDD:270835 125/302 (41%)
Cdk6NP_001178790.1 STKc_CDK6 11..300 CDD:270846 125/303 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.