DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63E and CDK3

DIOPT Version :9

Sequence 1:NP_001261373.1 Gene:Eip63E / 38433 FlyBaseID:FBgn0005640 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001249.1 Gene:CDK3 / 1018 HGNCID:1772 Length:305 Species:Homo sapiens


Alignment Length:300 Identity:156/300 - (52%)
Similarity:202/300 - (67%) Gaps:26/300 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 EAYVKLEPLGEGSYATVYKGFSKLTYQRVALKEIRLQ-EEEGAPFTAIREASLLKELKHSNIVTL 266
            :.:.|:|.:|||:|..|||..::.|.|.||||:|||. |.||.|.|||||.||||||||.|||.|
Human     2 DMFQKVEKIGEGTYGVVYKAKNRETGQLVALKKIRLDLEMEGVPSTAIREISLLKELKHPNIVRL 66

  Fly   267 HDIVHTRETLTFVFEYVNTDLSQYMEKHPGG-LDHRNVRLFLFQLLRGLSYCHKRRVLHRDVKPQ 330
            .|:||....|..|||:::.||.:||:..||. |....::.:|||||:|:|:||..||:|||:|||
Human    67 LDVVHNERKLYLVFEFLSQDLKKYMDSTPGSELPLHLIKSYLFQLLQGVSFCHSHRVIHRDLKPQ 131

  Fly   331 NLLISDCGELKLADFGLARAKSVPSHTYSHEVVTLWYRPPDVLLGSTEYSTSLDMWGVGCIFVEM 395
            ||||::.|.:||||||||||..||..||:|||||||||.|::||||..|:|::|:|.:||||.||
Human   132 NLLINELGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGSKFYTTAVDIWSIGCIFAEM 196

  Fly   396 VTGMPTFPGIRDTYDQLDKIFKLLGTPTEDTWPGVTHFPGYKPHKLGFYRPRKLGHNFPR----- 455
            ||....|||..: .|||.:||::||||:||||||||..|.||             .:||:     
Human   197 VTRKALFPGDSE-IDQLFRIFRMLGTPSEDTWPGVTQLPDYK-------------GSFPKWTRKG 247

  Fly   456 LYDII-----EGETIANGFLQLNPEQRLGADDALQHPYFA 490
            |.:|:     ||..:....||.:|.||:.|..||.||||:
Human   248 LEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFS 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63ENP_001261373.1 PLN00009 203..492 CDD:177649 156/299 (52%)
STKc_PCTAIRE_like 204..489 CDD:270835 154/296 (52%)
CDK3NP_001249.1 PLN00009 1..293 CDD:177649 156/299 (52%)
STKc_CDK2_3 3..286 CDD:270844 154/296 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.