DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42324 and BEGAIN

DIOPT Version :9

Sequence 1:NP_647819.3 Gene:CG42324 / 38430 FlyBaseID:FBgn0259224 Length:1037 Species:Drosophila melanogaster
Sequence 2:NP_001372014.1 Gene:BEGAIN / 57596 HGNCID:24163 Length:642 Species:Homo sapiens


Alignment Length:215 Identity:61/215 - (28%)
Similarity:98/215 - (45%) Gaps:24/215 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PAIAATPLATSAPAAAEIEQLQQALIEKQTQL-----YALESACLRETE-------RQVEL---E 82
            |.:....||.|:|:..:     .||.|::.:|     |........|||       .::||   :
Human    37 PRVLQGRLARSSPSIWD-----SALQEQKGELRKRLSYTTHKLEKLETEFDSTRHYLEIELRRAQ 96

  Fly    83 DSVIAWQDKYDRLYESHKRVQKVNQSLEDKMLKLVDRNAGERAQLTSDVATLSVRLAQANFNIAK 147
            :.:....:|..|:..::..:|::||.||||:.::......|:..|:.::..|:..|.:|...|.|
Human    97 EELEKVTEKLRRIQSNYMALQRINQELEDKLYRMGQHYEEEKRALSHEIVALNSHLLEAKVTIDK 161

  Fly   148 LQREIERYKADISLAIQLLQCKPDSFVSQKVSSLPIDIQSKVSAYMRLETNSHSDSECSNS-GVG 211
            |..:.|.|:.|.:||.|||||........|||.||.|.|.:||.:|.....|.....|..: ...
Human   162 LSEDNELYRKDCNLAAQLLQCSQTYGRVHKVSELPSDFQERVSLHMEKHGCSLPSPLCHPAYADS 226

  Fly   212 VATTASYKVLPASDSPPPSA 231
            |.|....|||   :.|.|::
Human   227 VPTCVIAKVL---EKPDPAS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42324NP_647819.3 DUF4200 49..156 CDD:290574 28/121 (23%)
BEGAINNP_001372014.1 Smc <55..>180 CDD:224117 33/124 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004208
OrthoInspector 1 1.000 - - otm42209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR28664
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5758
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.130

Return to query results.
Submit another query.