DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CCNE2

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_477097.1 Gene:CCNE2 / 9134 HGNCID:1590 Length:404 Species:Homo sapiens


Alignment Length:323 Identity:75/323 - (23%)
Similarity:134/323 - (41%) Gaps:83/323 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ARDIFLTMREQELSRRPLFY------------LSPQLNERRRMLQLLKLATSAHKLSRCALHLAV 92
            :::::|.|.::| ||    |            |.||:  |..:|..|......:.|.|...:||.
Human   110 SKEVWLNMLKKE-SR----YVHDKHFEVLHSDLEPQM--RSILLDWLLEVCEVYTLHRETFYLAQ 167

  Fly    93 YYMDRFVDYYK-IRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKI 156
            .:.|||:...| |..:.|.|:.||.|.||:::|  :.:.|:..|...:...|.:..:...:|..|
Human   168 DFFDRFMLTQKDINKNMLQLIGITSLFIASKLE--EIYAPKLQEFAYVTDGACSEEDILRMELII 230

  Fly   157 LCFLNFELIRPTTASFVELFACSFLTRSDFKNYIE-MLDEYERNHHTQPYQRYISFEEMLSILAQ 220
            |..|.:||...|..|::.|    ||.....|:..: :|.:|.:       :.:|...::|. |..
Human   231 LKALKWELCPVTIISWLNL----FLQVDALKDAPKVLLPQYSQ-------ETFIQIAQLLD-LCI 283

  Fly   221 LLLRMADYTLYISRFANDLPSLLAAA-C----IAAVRQVSGVRRWS------EYLVGLTSYTEAN 274
            |.:...::...|         |.||| |    |..|::.||: .|.      :::|         
Human   284 LAIDSLEFQYRI---------LTAAALCHFTSIEVVKKASGL-EWDSISECVDWMV--------- 329

  Fly   275 VEPYMNVLTDYYYYHVIQTDYGSP-SVQTNQSLASPDSGFEESFTENTN-LVVSDEVVTVETY 335
              |::||:..           .|| .::|.:.:...|   ..:...:|| |.:.:||..:.|:
Human   330 --PFVNVVKS-----------TSPVKLKTFKKIPMED---RHNIQTHTNYLAMLEEVNYINTF 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 36/134 (27%)
Cyclin_C <225..>286 CDD:281044 15/71 (21%)
CCNE2NP_477097.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44
Cyclin_N 112..239 CDD:278560 37/135 (27%)
Cyclin_C 241..361 CDD:281044 31/166 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.