DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CCNB2

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_004692.1 Gene:CCNB2 / 9133 HGNCID:1580 Length:398 Species:Homo sapiens


Alignment Length:316 Identity:86/316 - (27%)
Similarity:128/316 - (40%) Gaps:72/316 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VERLAKTHW-----LTDYARDIFLTMREQEL--SRRPLFYLSPQLNERRR--MLQLLKLATSAHK 82
            :|.:....|     .:||.:||:..:|:.|:  |..|.|.....:|.|.|  ::..|....|..:
Human   117 IEDIDNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFR 181

  Fly    83 LSRCALHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAF 147
            |.:..|::.|..||||:....:...||.||.||.|.:|::.|  :.|.|...:...:..||||:.
Human   182 LLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYE--EMFSPNIEDFVYITDNAYTSS 244

  Fly   148 EYKAVERKILCFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFE 212
            :.:.:|..||..|.|||.||        ....||.|:      ....|.:...||          
Human   245 QIREMETLILKELKFELGRP--------LPLHFLRRA------SKAGEVDVEQHT---------- 285

  Fly   213 EMLSILAQLL--LRMADYTLYISRFANDLPSLLAAACIAAVRQVSGVRRWSEYLVGLTSYTEANV 275
                 ||:.|  |.:.||.:     .:..||.:|||.....::|.|..:|:......|.|||..|
Human   286 -----LAKYLMELTLIDYDM-----VHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEV 340

  Fly   276 EPYM-----NV------LTDYYYYHVIQTDYGSPSV-------QTN----QSLASP 309
            ...|     ||      ||.:.   .|:..|.|..:       |.|    :.||||
Human   341 LEVMQHMAKNVVKVNENLTKFI---AIKNKYASSKLLKISMIPQLNSKAVKDLASP 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 39/125 (31%)
Cyclin_C <225..>286 CDD:281044 20/71 (28%)
CCNB2NP_004692.1 Cyclin_N 137..262 CDD:278560 40/126 (32%)
Cyclin_C 264..382 CDD:281044 34/154 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.