DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CCNG2

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_004345.1 Gene:CCNG2 / 901 HGNCID:1593 Length:344 Species:Homo sapiens


Alignment Length:345 Identity:74/345 - (21%)
Similarity:138/345 - (40%) Gaps:88/345 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 REQELSRRPLFYLSPQLNERR-----RMLQLLKLATSAHKLSRC--ALHLAVYYMDRFVDYYKIR 105
            ||:.||   |...:|: |:..     |..::..|.:.|:....|  ...|||..:|||:...|::
Human    34 REKGLS---LIEATPE-NDNTLCPGLRNAKVEDLRSLANFFGSCTETFVLAVNILDRFLALMKVK 94

  Fly   106 PDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFLNFELIRPTTA 170
            |..|..:.:....:||:|...|..||...::.|:.:...||.:.|.:|:.|...|::||...|..
Human    95 PKHLSCIGVCSFLLAARIVEEDCNIPSTHDVIRISQCKCTASDIKRMEKIISEKLHYELEATTAL 159

  Fly   171 SFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLLRMADYTLYISRF 235
            :|:.|:....|.                  ||...:..:|.:::.:.|.....|:.        |
Human   160 NFLHLYHTIILC------------------HTSERKEILSLDKLEAQLKACNCRLI--------F 198

  Fly   236 ANDLPSLLAAACI-AAVRQVSGVRRWSEYLVGLTSYTEANVEPYMNVLTDYYYYHVIQT----DY 295
            :...||:||...: ..|..:..| ...|.|:.:..:::.|.       |:::|:..:.:    :|
Human   199 SKAKPSVLALCLLNLEVETLKSV-ELLEILLLVKKHSKIND-------TEFFYWRELVSKCLAEY 255

  Fly   296 GSP--------------SVQTNQSLAS-----------PDSG-FEESFTENT--NLVVSDEVVTV 332
            .||              |.:|.|:|.:           |:.| |:||.:|::  ::...:|    
Human   256 SSPECCKPDLKKLVWIVSRRTAQNLHNSYYSVPELPTIPEGGCFDESESEDSCEDMSCGEE---- 316

  Fly   333 ETYNIITVQLQDPSPHSSTF 352
                  ::....||....||
Human   317 ------SLSSSPPSDQECTF 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 33/122 (27%)
Cyclin_C <225..>286 CDD:281044 11/61 (18%)
CCNG2NP_004345.1 CYCLIN_CCNG2 55..150 CDD:410287 25/94 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..320 4/28 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.