DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CCNG1

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001350944.1 Gene:CCNG1 / 900 HGNCID:1592 Length:295 Species:Homo sapiens


Alignment Length:257 Identity:58/257 - (22%)
Similarity:111/257 - (43%) Gaps:53/257 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVER 154
            |||..:|||:...|::|..|..|.::|.::|.:....:..:|..:::.|:.:..:|..:...:|:
Human    75 LAVNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATDLIRISQYRFTVSDLMRMEK 139

  Fly   155 KIL---CFLNFELIRPTTA-SFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQR--YISFEE 213
            .:|   |:    .::.||| .|::|             |..:|.|      ..|.:|  .|:||.
Human   140 IVLEKVCW----KVKATTAFQFLQL-------------YYSLLQE------NLPLERRNSINFER 181

  Fly   214 MLSILAQLLLRMADYTLYISRFANDLPSLLAAACIAAVRQVSGVRRWSEYLVGLTSYTEANVEPY 278
            :.:.|.....|:.        |:...||:||.:.||...|.......:|.:..|..:::.|... 
Human   182 LEAQLKACHCRII--------FSKAKPSVLALSIIALEIQAQKCVELTEGIECLQKHSKINGRD- 237

  Fly   279 MNVLTDYYYYHVIQ---TDYGS-----PSVQTNQSLASPDSG--FEESFTENTNLVVSDEVV 330
               ||  ::..::.   |:|.|     |:||..:.:.|..:.  .:.|:...|:|....|:|
Human   238 ---LT--FWQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHSYYRITHLPTIPEMV 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 18/76 (24%)
Cyclin_C <225..>286 CDD:281044 13/60 (22%)
CCNG1NP_001350944.1 CYCLIN_CCNG1 51..148 CDD:410286 18/76 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.