DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CCNE1

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001229.1 Gene:CCNE1 / 898 HGNCID:1589 Length:410 Species:Homo sapiens


Alignment Length:321 Identity:67/321 - (20%)
Similarity:135/321 - (42%) Gaps:48/321 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MREQE-LSRRPLFYLSPQLNERRRMLQLLKLATSAHKLSRCALHLAVYYMDRFV-DYYKIRPDKL 109
            :|:|. |.:.||  |.|::  |..:|..|......:||.|...:||..:.||:: ....:....|
Human   128 LRDQHFLEQHPL--LQPKM--RAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLL 188

  Fly   110 LLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFLNFELIRPTTASFVE 174
            .|:.|:.|.|||::|  :.:.|:..:...:...|.:..|...:|..|:..|.:.|...|..|::.
Human   189 QLIGISSLFIAAKLE--EIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLN 251

  Fly   175 LF-ACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLLRMADYTLYISRFAND 238
            :: ..::|  :|....  :|.:|       |.|.:|...|:|.:..            :.....:
Human   252 VYMQVAYL--NDLHEV--LLPQY-------PQQIFIQIAELLDLCV------------LDVDCLE 293

  Fly   239 LP-SLLAAACIAAVRQVSGVRRWSEYLVGLTSYTEANVEPYMNVLTDYYYYHVIQTDYGSPSVQT 302
            .| .:|||   :|:...|.    ||.:..::.|...::|   |.:.....:.::..:.||..::.
Human   294 FPYGILAA---SALYHFSS----SELMQKVSGYQWCDIE---NCVKWMVPFAMVIRETGSSKLKH 348

  Fly   303 NQSLASPDSGFEESFTENTNLVVSDEVVTVETYNIITVQLQDPSPHSSTFLPKEQTNLKRS 363
            .:.:|..|:...::..::.:|:  |:   ......:..:....||..|..|...|:..|:|
Human   349 FRGVADEDAHNIQTHRDSLDLL--DK---ARAKKAMLSEQNRASPLPSGLLTPPQSGKKQS 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 31/118 (26%)
Cyclin_C <225..>286 CDD:281044 11/61 (18%)
CCNE1NP_001229.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Cyclin_N 115..242 CDD:306612 31/119 (26%)
Cyclin_C 245..363 CDD:308564 26/150 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..410 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.