DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CCNA1

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_003905.1 Gene:CCNA1 / 8900 HGNCID:1577 Length:465 Species:Homo sapiens


Alignment Length:256 Identity:68/256 - (26%)
Similarity:107/256 - (41%) Gaps:38/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LTDYARDIFLTMREQELSRRP-LFYL--SPQLNERRR--MLQLLKLATSAHKLSRCALHLAVYYM 95
            :|:||.:|:..:||.|:..|| ..|:  .|.:.|..|  ::..|......:||....|:|||.::
Human   208 VTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFL 272

  Fly    96 DRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFL 160
            |||:....:...||.||....:.:|::.|  :.:.|...|...:..:.||..:...:|..:|..|
Human   273 DRFLSCMSVLRGKLQLVGTAAMLLASKYE--EIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVL 335

  Fly   161 NFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQLLLRM 225
            .|:|..|||..|:    ..:|.|.......|.|.:|                     :|:|.|..
Human   336 AFDLTVPTTNQFL----LQYLRRQGVCVRTENLAKY---------------------VAELSLLE 375

  Fly   226 ADYTLYISRFANDLPSLLAAACIAAVRQVSGVRRWSEYLVGLTSYTEANVEPYMNVLTDYY 286
            ||      .|...||||:|||.............|.|.|...|.|:.:.:.|.::.|...|
Human   376 AD------PFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAY 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 34/126 (27%)
Cyclin_C <225..>286 CDD:281044 17/60 (28%)
CCNA1NP_003905.1 Cyclin_N2 71..>145 CDD:293109
Cyclin_N 214..340 CDD:278560 34/127 (27%)
Cyclin_C 342..459 CDD:281044 30/120 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.