DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CCNA2

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_001228.2 Gene:CCNA2 / 890 HGNCID:1578 Length:432 Species:Homo sapiens


Alignment Length:266 Identity:74/266 - (27%)
Similarity:114/266 - (42%) Gaps:41/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ERLAKTHWLTDYARDIFLTMREQELSRRP-LFYLSPQ---LNERRRML-QLLKLATSAHKLSRCA 87
            |:....:.:.||..||...:||.|:..:| :.|:..|   .|..|.:| ..|......:||....
Human   167 EKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNET 231

  Fly    88 LHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAV 152
            |||||.|:|||:....:...||.||....:.:|::.|  :.:.|..:|...:..:.||..:...:
Human   232 LHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFE--EIYPPEVAEFVYITDDTYTKKQVLRM 294

  Fly   153 ERKILCFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSI 217
            |..:|..|.|:|..||...|:..:   ||                   |.||..  ...|.:...
Human   295 EHLVLKVLTFDLAAPTVNQFLTQY---FL-------------------HQQPAN--CKVESLAMF 335

  Fly   218 LAQLLLRMAD-YTLYISRFANDLPSLLAAACI-AAVRQVSGVRRWSEYLVGLTSYTEANVEPYMN 280
            |.:|.|..|| |..|       |||::|.|.. .|:..|:| :.|.|.|:..|.||..:::|.:.
Human   336 LGELSLIDADPYLKY-------LPSVIAGAAFHLALYTVTG-QSWPESLIRKTGYTLESLKPCLM 392

  Fly   281 VLTDYY 286
            .|...|
Human   393 DLHQTY 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 37/126 (29%)
Cyclin_C <225..>286 CDD:281044 20/62 (32%)
CCNA2NP_001228.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..45
Cyclin_N2 28..166 CDD:406812
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..75
CYCLIN_CCNA2_rpt1 175..305 CDD:410264 38/131 (29%)
CYCLIN_CCNA2_rpt2 309..419 CDD:410267 33/122 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.