DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CLB2

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_015444.1 Gene:CLB2 / 856236 SGDID:S000006323 Length:491 Species:Saccharomyces cerevisiae


Alignment Length:302 Identity:75/302 - (24%)
Similarity:127/302 - (42%) Gaps:54/302 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VVDRKLK---KTCPQ----------ADVERLAKTHWLTDYARDIFLTMREQE---LSRRPLFYLS 61
            :|:::|.   |.|.:          .|.|.:.....:::|..|||..:.:.|   |.::...|..
Yeast   190 IVEQELPKKFKVCDENGKEEYEWEDLDAEDVNDPFMVSEYVNDIFEYLHQLEVITLPKKEDLYQH 254

  Fly    62 PQLNERRRML--QLLKLATSAHKLSRCALHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIE 124
            ..:::.|.:|  .|:|:......|.. .|:||:..||||:....::.|||.||..:||.||::.|
Yeast   255 RNIHQNRDILVNWLVKIHNKFGLLPE-TLYLAINIMDRFLGKELVQLDKLQLVGTSCLFIASKYE 318

  Fly   125 NTDAFIPRYSEMNRLVKNAYTAFEYKAVERKILCFLNFELIRPTTASFVELFACSFLTRSDFKNY 189
              :.:.|...........|.|..|.|..|:.||..|.|.|..|...:|:              ..
Yeast   319 --EVYSPSIKHFASETDGACTEDEIKEGEKFILKTLKFNLNYPNPMNFL--------------RR 367

  Fly   190 IEMLDEYERNHHTQPYQRYISFEEMLSILAQLLLRMADYTLYISRFANDLPSLLAAACIAAVRQV 254
            |...|:|:....|               ||:.||   :.:|...||...||||.|||.:...|::
Yeast   368 ISKADDYDIQSRT---------------LAKFLL---EISLVDFRFIGILPSLCAAAAMFMSRKM 414

  Fly   255 SGVRRWSEYLVGLT-SYTEANVEPYMNVLTDYYYYHVIQTDY 295
            .|..:|...|:..: .||:..:.|..:::.||....::..::
Yeast   415 LGKGKWDGNLIHYSGGYTKEELAPVCHMIMDYLVSPIVHDEF 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 38/126 (30%)
Cyclin_C <225..>286 CDD:281044 18/61 (30%)
CLB2NP_015444.1 COG5024 8..487 CDD:227357 75/302 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.