DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CLN1

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_013926.1 Gene:CLN1 / 855239 SGDID:S000004812 Length:546 Species:Saccharomyces cerevisiae


Alignment Length:198 Identity:41/198 - (20%)
Similarity:75/198 - (37%) Gaps:37/198 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VAAEQNIFVVDRKLKKTCPQADVERLAKTHWLTDYARDIFLTMREQELSRRP---LFYLSPQLN- 65
            |.|:|..:.::        .::.|.|.....:.:|..:|...:..|....:|   |....|::| 
Yeast    12 VTAKQTYYPIE--------LSNAELLTHYETIQEYHEEISQNVLVQSSKTKPDIKLIDQQPEMNP 68

  Fly    66 --ERRRMLQLLKLATSAHKLSRCALHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQI----- 123
              .|..::..|...:...::|......||.:.||:.....:..|:..||..|||.:||:.     
Yeast    69 HQTREAIVTFLYQLSVMTRVSNGIFFHAVRFYDRYCSKRVVLKDQAKLVVGTCLWLAAKTWGGCN 133

  Fly   124 ----------------ENTDAFIPRYSEMNRLV--KNAYTAFEYKAVERKILCFLNFELIRPTTA 170
                            .|..|.|||.||:....  .:.:....:..:||.||..||:::..|...
Yeast   134 HIINNVSIPTGGRFYGPNPRARIPRLSELVHYCGGSDLFDESMFIQMERHILDTLNWDVYEPMIN 198

  Fly   171 SFV 173
            .::
Yeast   199 DYI 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 34/150 (23%)
Cyclin_C <225..>286 CDD:281044
CLN1NP_013926.1 COG5024 31..539 CDD:227357 36/171 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.