DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CCNB3

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:XP_016885402.1 Gene:CCNB3 / 85417 HGNCID:18709 Length:1404 Species:Homo sapiens


Alignment Length:272 Identity:58/272 - (21%)
Similarity:104/272 - (38%) Gaps:49/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YARDIFLTMREQELSR----RPLFYLSPQLNE--------RRRMLQLLKLATSAHKLSRCALHLA 91
            ||::||..|:|:|:..    ...|.|:..:|.        |..::..|.....:.:::...|:||
Human  1130 YAKEIFSYMKEREIEETAQSHEQFILTDYMNRQIEITSDMRAILVDWLVEVQVSFEMTHETLYLA 1194

  Fly    92 VYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEYKAVERKI 156
            |..:|.::.....:.|||.|:..|...|||:.|..::  ||..:...:..:.|...|..::|..|
Human  1195 VKLVDLYLMKAVCKKDKLQLLGATAFMIAAKFEEHNS--PRVDDFVYICDDNYQRSEVLSMEINI 1257

  Fly   157 LCFLNFELIRPTTASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISFEEMLSILAQL 221
            |..|..::..|....|:..:|....|                |..|....|||            
Human  1258 LNVLKCDINIPIAYHFLRRYARCIHT----------------NMKTLTLSRYI------------ 1294

  Fly   222 LLRMADYTLYISRFANDLPSLLAAACIAAVRQVSGVRRWSEYLVGLTSYTEANVEP---YMNVLT 283
                .:.||....:..:..|.||||.:.....:..:..|..:|...:.|:.:.:.|   .:|.|.
Human  1295 ----CEMTLQEYHYVQEKASKLAAASLLLALYMKKLGYWVPFLEHYSGYSISELHPLVRQLNKLL 1355

  Fly   284 DYYYYHVIQTDY 295
            .:..|..::..|
Human  1356 TFSSYDSLKAVY 1367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 32/133 (24%)
Cyclin_C <225..>286 CDD:281044 13/63 (21%)
CCNB3XP_016885402.1 Cyclin_N 1133..1266 CDD:306612 32/134 (24%)
Cyclin_C 1268..1384 CDD:308564 24/132 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D993640at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.