DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CLB6

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_011623.3 Gene:CLB6 / 853003 SGDID:S000003341 Length:380 Species:Saccharomyces cerevisiae


Alignment Length:362 Identity:78/362 - (21%)
Similarity:136/362 - (37%) Gaps:101/362 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EQKVAAEQNIFVVDR-KLKKTCPQADVERLAKT------------------------HW------ 35
            |:||.:|.|...:|. :|.:...|.|...|.||                        .|      
Yeast    45 EKKVLSEVNSNKIDSLQLPRGKLQRDSTHLEKTRKRQLSNDSTDPIEPKTVKKIKCHQWKNLDSI 109

  Fly    36 -------LTDYARDIFLTMREQELSRRPLF-YL----SP-QLNERRRMLQLLKLATSAHKLSRC- 86
                   :.:|...||..:.|:|:...|.. ||    || .|....|.| |:......|:...| 
Yeast   110 EMDDPFMVAEYTDSIFSHLYEKEIQMLPTHNYLMDTQSPYHLKSSMRAL-LIDWLVEVHEKFHCL 173

  Fly    87 --ALHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAFEY 149
              .|.||:..:|||:....::.:||.|:.||||.||.:.|  :..:|:.:....:...|.|....
Yeast   174 PETLFLAINLLDRFLSQNVVKLNKLQLLCITCLFIACKFE--EVKLPKITNFAYVTDGAATVEGI 236

  Fly   150 KAVERKILCFLNFELIRPTTASFVELFACSFLTRSDFKNY-IEMLDEYERNHHTQPYQRYISFEE 213
            :..|..:|..|.:.:..|...:|:..     ::::|  || ||     .||              
Yeast   237 RKAELFVLSSLGYNISLPNPLNFIRR-----ISKAD--NYCIE-----TRN-------------- 275

  Fly   214 MLSILAQLLLRMADYTLYISRFANDLPSLLAAACIAAVRQVSGVR-RWSEYLVGLTSYTEANVEP 277
                :|:.::   :|::..::|.:..||.|||..:...|::.... :|.|..:..:...:...:|
Yeast   276 ----MAKFIM---EYSICCNKFIHLKPSYLAAMSMYIARKIKNENSKWDETFIHYSGGIDIESDP 333

  Fly   278 YMNVLTDYYYYHVIQTDYGSPSVQTNQSLASPDSGFE 314
            ...             |:.|..|   :.:|.||:..:
Yeast   334 AFK-------------DFISELV---EDIAVPDTNLD 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 37/130 (28%)
Cyclin_C <225..>286 CDD:281044 11/61 (18%)
CLB6NP_011623.3 COG5024 1..380 CDD:227357 78/362 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.