DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycJ and CLN3

DIOPT Version :9

Sequence 1:NP_523903.1 Gene:CycJ / 38428 FlyBaseID:FBgn0010317 Length:386 Species:Drosophila melanogaster
Sequence 2:NP_009360.1 Gene:CLN3 / 851191 SGDID:S000000038 Length:580 Species:Saccharomyces cerevisiae


Alignment Length:420 Identity:80/420 - (19%)
Similarity:153/420 - (36%) Gaps:92/420 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VERLAKTHW--LTDYARDIFLTMREQELSRRPLFYLS-----PQLNERRRML--QLLKLATSAHK 82
            |:|..:.|.  :::|..|..........:.|||:.|:     ||:|.:.|.|  ..:....:...
Yeast    59 VKRELQAHHSAISEYNNDQLDHYFRLSHTERPLYNLTNFNSQPQVNPKMRFLIFDFIMYCHTRLN 123

  Fly    83 LSRCALHLAVYYMDRFVDYYKIRPDKLLLVAITCLHIAAQIENTDAFIPRYSEMNRLVKNAYTAF 147
            ||...|.|....:|::...:.|:.....|:::|.|.|:::..::...:.....:..|..|.|:..
Yeast   124 LSTSTLFLTFTILDKYSSRFIIKSYNYQLLSLTALWISSKFWDSKNRMATLKVLQNLCCNQYSIK 188

  Fly   148 EYKAVERKILCFLNFELIRPTT-ASFVELFACSFLTRSDFKNYIEMLDEYERNHHTQPYQRYISF 211
            ::..:|..:...|::.:.:..| .|::::|.  |.:.|.....:.:         :.|.:.:|  
Yeast   189 QFTTMEMHLFKSLDWSICQSATFDSYIDIFL--FQSTSPLSPGVVL---------SAPLEAFI-- 240

  Fly   212 EEMLSIL---------------------------AQLLLRMADYTLYISRFANDLPSLLAAACIA 249
            ::.|::|                           |.:|..:|.:.|.:| |..| .||:|...|.
Yeast   241 QQKLALLNNAAGTAINKSSSSQGPSLNINEIKLGAIMLCELASFNLELS-FKYD-RSLIALGAIN 303

  Fly   250 AVR---QVSGVRRWSEYLVGLTSY---TEANVEPYMNVLTDYYYYHVIQTDYGS-PSVQTNQSLA 307
            .::   .......|....:.|...   .:..:....|.|.|      |..|..| ||...::.|.
Yeast   304 LIKLSLNYYNSNLWENINLALEENCQDLDIKLSEISNTLLD------IAMDQNSFPSSFKSKYLN 362

  Fly   308 SPDSGFEESFTEN-TNLVV---------SDEVVTVETYNIITVQLQDPSP----HSSTFLPKEQT 358
            |..:...:|..:. .|..:         |.|:.|:  ||.|..|..|...    :|:...||..|
Yeast   363 SNKTSLAKSLLDALQNYCIQLKLEEFYRSQELETM--YNTIFAQSFDSDSLTCVYSNATTPKSAT 425

  Fly   359 --NLKRSRFEDDTENQHPLKHAKVESVAKD 386
              :.....|.|         |..:..:.||
Yeast   426 VSSAATDYFSD---------HTHLRRLTKD 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycJNP_523903.1 Cyclin_N 42..164 CDD:278560 25/128 (20%)
Cyclin_C <225..>286 CDD:281044 14/66 (21%)
CLN3NP_009360.1 COG5024 35..576 CDD:227357 80/420 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.